Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3033
Gene name
LocationContig_27:22416..23837
Strand+
Gene length (bp)1421
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.9E-52 39 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 37 383 2.0E-76
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 36 368 3.0E-55
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 37 383 3.0E-52
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 37 383 5.0E-51
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 37 384 9.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 37 383 2.0E-76
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 36 368 3.0E-55
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 37 383 3.0E-52
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 37 383 5.0E-51
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 37 384 9.0E-50
sp|Q8HXI3|S38AB_MACFA Putative sodium-coupled neutral amino acid transporter 11 OS=Macaca fascicularis GN=SLC38A11 PE=2 SV=1 37 383 2.0E-47
sp|Q08AI6|S38AB_HUMAN Putative sodium-coupled neutral amino acid transporter 11 OS=Homo sapiens GN=SLC38A11 PE=2 SV=1 37 383 2.0E-46
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 35 357 5.0E-25
sp|Q6WWW3|S38A6_RAT Probable sodium-coupled neutral amino acid transporter 6 OS=Rattus norvegicus GN=Slc38a6 PE=2 SV=1 38 349 5.0E-23
sp|G3UVW3|S38A6_MOUSE Probable sodium-coupled neutral amino acid transporter 6 OS=Mus musculus GN=Slc38a6 PE=2 SV=1 38 368 3.0E-22
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 37 367 4.0E-21
sp|Q6JWR2|S38A7_RAT Putative sodium-coupled neutral amino acid transporter 7 OS=Rattus norvegicus GN=Slc38a7 PE=2 SV=1 35 359 1.0E-20
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 34 342 1.0E-20
sp|A7E3U5|S38A7_BOVIN Putative sodium-coupled neutral amino acid transporter 7 OS=Bos taurus GN=SLC38A7 PE=2 SV=1 35 359 2.0E-20
sp|Q8BWH0|S38A7_MOUSE Putative sodium-coupled neutral amino acid transporter 7 OS=Mus musculus GN=Slc38a7 PE=1 SV=1 35 359 3.0E-20
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 34 342 5.0E-20
sp|Q5R9F5|S38A7_PONAB Putative sodium-coupled neutral amino acid transporter 7 OS=Pongo abelii GN=SLC38A7 PE=2 SV=1 35 359 2.0E-19
sp|Q9NVC3|S38A7_HUMAN Putative sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens GN=SLC38A7 PE=1 SV=1 35 359 2.0E-19
sp|Q8IZM9|S38A6_HUMAN Probable sodium-coupled neutral amino acid transporter 6 OS=Homo sapiens GN=SLC38A6 PE=1 SV=2 38 362 3.0E-19
sp|Q6DFE7|S38A7_XENLA Putative sodium-coupled neutral amino acid transporter 7 OS=Xenopus laevis GN=slc38a7 PE=2 SV=1 42 357 9.0E-19
sp|Q9H2H9|S38A1_HUMAN Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens GN=SLC38A1 PE=1 SV=1 32 346 2.0E-18
sp|Q5R443|S38A1_PONAB Sodium-coupled neutral amino acid transporter 1 OS=Pongo abelii GN=SLC38A1 PE=2 SV=1 32 346 3.0E-18
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 34 342 5.0E-18
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 32 346 3.0E-17
sp|A6NNN8|S38A8_HUMAN Putative sodium-coupled neutral amino acid transporter 8 OS=Homo sapiens GN=SLC38A8 PE=1 SV=1 34 340 2.0E-15
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 32 346 6.0E-15
sp|Q5HZH7|S38A8_MOUSE Putative sodium-coupled neutral amino acid transporter 8 OS=Mus musculus GN=Slc38a8 PE=2 SV=1 34 340 1.0E-14
sp|Q5I012|S38AA_MOUSE Putative sodium-coupled neutral amino acid transporter 10 OS=Mus musculus GN=Slc38a10 PE=1 SV=2 34 368 2.0E-13
sp|Q5E9S9|S38A5_BOVIN Sodium-coupled neutral amino acid transporter 5 OS=Bos taurus GN=SLC38A5 PE=2 SV=1 169 367 3.0E-13
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 38 368 5.0E-13
sp|O74327|AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt5 PE=3 SV=1 39 335 1.0E-12
sp|Q8WUX1|S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens GN=SLC38A5 PE=1 SV=1 169 367 1.0E-12
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 39 363 2.0E-12
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 172 349 2.0E-12
sp|Q28I47|S38A8_XENTR Putative sodium-coupled neutral amino acid transporter 8 OS=Xenopus tropicalis GN=slc38a8 PE=2 SV=1 34 340 2.0E-12
sp|Q969I6|S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens GN=SLC38A4 PE=1 SV=1 172 346 3.0E-12
sp|E9PT23|S38AA_RAT Putative sodium-coupled neutral amino acid transporter 10 OS=Rattus norvegicus GN=Slc38a10 PE=2 SV=2 34 368 4.0E-12
sp|A2VCW5|S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus GN=Slc38a5 PE=1 SV=1 169 367 7.0E-12
sp|Q3U1J0|S38A5_MOUSE Sodium-coupled neutral amino acid transporter 5 OS=Mus musculus GN=Slc38a5 PE=1 SV=1 169 367 8.0E-12
sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT6 PE=1 SV=1 57 276 4.0E-11
sp|Q9EQ25|S38A4_RAT Sodium-coupled neutral amino acid transporter 4 OS=Rattus norvegicus GN=Slc38a4 PE=1 SV=1 172 346 3.0E-10
sp|Q5RC98|S38AA_PONAB Putative sodium-coupled neutral amino acid transporter 10 OS=Pongo abelii GN=SLC38A10 PE=2 SV=1 34 368 7.0E-10
sp|Q9HBR0|S38AA_HUMAN Putative sodium-coupled neutral amino acid transporter 10 OS=Homo sapiens GN=SLC38A10 PE=1 SV=2 34 368 8.0E-10
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 172 346 2.0E-09
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 51 363 3.0E-09
sp|Q6PCF9|S38AA_XENLA Putative sodium-coupled neutral amino acid transporter 10 OS=Xenopus laevis GN=slc38a10 PE=2 SV=1 34 366 4.0E-09
sp|Q5F468|S38A2_CHICK Sodium-coupled neutral amino acid transporter 2 OS=Gallus gallus GN=SLC38A2 PE=2 SV=2 39 346 1.0E-08
sp|Q9JHE5|S38A2_RAT Sodium-coupled neutral amino acid transporter 2 OS=Rattus norvegicus GN=Slc38a2 PE=1 SV=1 39 346 1.0E-08
sp|P38176|AVT5_YEAST Vacuolar amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT5 PE=3 SV=2 57 367 3.0E-08
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 119 369 6.0E-07
sp|A2VE31|S38A2_BOVIN Sodium-coupled neutral amino acid transporter 2 OS=Bos taurus GN=SLC38A2 PE=2 SV=1 172 346 8.0E-07
sp|Q19425|S38A9_CAEEL Sodium-coupled neutral amino acid transporter 9 homolog OS=Caenorhabditis elegans GN=F13H10.3 PE=3 SV=2 239 361 1.0E-06
sp|Q96QD8|S38A2_HUMAN Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens GN=SLC38A2 PE=1 SV=2 172 346 2.0E-06
sp|A1YG32|S38A2_PANPA Sodium-coupled neutral amino acid transporter 2 OS=Pan paniscus GN=SLC38A2 PE=3 SV=1 172 346 2.0E-06
sp|P40501|AVT7_YEAST Vacuolar amino acid transporter 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT7 PE=1 SV=1 60 270 6.0E-06
sp|Q8CFE6|S38A2_MOUSE Sodium-coupled neutral amino acid transporter 2 OS=Mus musculus GN=Slc38a2 PE=1 SV=1 132 346 8.0E-06
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 51 347 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22
2 106 123 17
3 135 157 22
4 177 199 22
5 211 233 22
6 253 275 22
7 295 317 22
8 321 343 22
9 350 372 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3033
MRDDEGVRLERVVSGGEDDEEAAMGHLETQPMLSSKLSGTTSFQGTVEHCFGRPGMVAISLAQWVFAFGGMVAFA
VIVGDTIPHVLTAVWPGLASVPVLGLLTDRRVAIIVFIMGVSYPLTLYRDIAKASSLAKASTFALIGMIVIVTTV
LIQGILVPSSARGTFTTPLLTLNTGVFQAIGVISFAFVCHHNSLLIYGSLRTPTIDNFSRVTHYSTTVSMLACLT
MALAGFLTFGDKTAGNVLNNFPPSNNMVNLARLFFGLNMLTTMPLEAFVCREVMLTYWFPHSAFDLGRHVLLSTG
LVLAATALSLLTCDLGVVFELVGATSAVVMAYILPPLCYVRLASSSWRTYVAYLIVVFGVAVMAISVLQAGASLL
RGREAAACT*
Coding >Ophun1|3033
ATGCGTGACGACGAGGGCGTGCGGCTCGAGAGGGTTGTTTCGGGGGGCGAGGACGATGAGGAGGCTGCCATGGGC
CATCTCGAGACGCAGCCCATGCTATCCTCCAAGCTCAGCGGCACCACCAGCTTCCAGGGCACCGTCGAGCACTGC
TTCGGCAGGCCCGGCATGGTGGCCATCAGTCTGGCCCAGTGGGTCTTCGCCTTTGGCGGCATGGTGGCTTTTGCT
GTCATTGTTGGCGATACCATCCCTCATGTTCTTACCGCCGTTTGGCCGGGGTTGGCTTCCGTTCCGGTGCTGGGC
CTCTTGACGGATAGACGGGTTGCCATTATCGTCTTCATCATGGGCGTCAGCTACCCACTAACACTCTACCGCGAC
ATCGCCAAGGCAAGTTCTCTGGCCAAAGCTAGCACCTTTGCCCTCATCGGCATGATCGTCATCGTCACCACCGTC
CTAATCCAAGGCATCCTCGTCCCCTCCTCCGCCCGCGGCACCTTCACAACCCCCCTCCTAACCCTCAACACCGGC
GTCTTCCAAGCCATCGGCGTAATCTCCTTCGCCTTCGTCTGCCACCACAACTCCCTCCTCATCTACGGCTCCCTC
CGCACCCCAACAATCGACAACTTCTCCCGCGTAACCCACTACTCAACCACCGTCTCCATGCTGGCCTGCCTAACC
ATGGCCCTCGCCGGCTTCCTCACCTTCGGCGACAAGACAGCCGGCAACGTGCTCAACAACTTCCCCCCCTCCAAC
AACATGGTCAACCTCGCCCGCCTCTTCTTCGGCCTCAACATGCTCACCACGATGCCCCTCGAAGCCTTCGTCTGC
AGGGAAGTCATGCTAACCTACTGGTTCCCCCACTCCGCCTTCGACCTCGGACGACACGTGCTCCTCAGCACGGGC
CTCGTCCTCGCCGCCACGGCCCTCAGCCTGCTTACCTGCGACCTAGGCGTCGTCTTCGAGCTCGTCGGCGCCACT
AGCGCCGTCGTCATGGCCTACATCCTCCCTCCGCTCTGCTACGTCCGCCTCGCCTCGTCCAGTTGGCGCACCTAC
GTCGCCTACCTCATCGTCGTCTTTGGCGTCGCCGTCATGGCCATCAGTGTTTTGCAGGCTGGGGCTTCGCTGCTG
AGGGGCAGGGAGGCCGCTGCTTGTACATGA
Transcript >Ophun1|3033
ATGCGTGACGACGAGGGCGTGCGGCTCGAGAGGGTTGTTTCGGGGGGCGAGGACGATGAGGAGGCTGCCATGGGC
CATCTCGAGACGCAGCCCATGCTATCCTCCAAGCTCAGCGGCACCACCAGCTTCCAGGGCACCGTCGAGCACTGC
TTCGGCAGGCCCGGCATGGTGGCCATCAGTCTGGCCCAGTGGGTCTTCGCCTTTGGCGGCATGGTGGCTTTTGCT
GTCATTGTTGGCGATACCATCCCTCATGTTCTTACCGCCGTTTGGCCGGGGTTGGCTTCCGTTCCGGTGCTGGGC
CTCTTGACGGATAGACGGGTTGCCATTATCGTCTTCATCATGGGCGTCAGCTACCCACTAACACTCTACCGCGAC
ATCGCCAAGGCAAGTTCTCTGGCCAAAGCTAGCACCTTTGCCCTCATCGGCATGATCGTCATCGTCACCACCGTC
CTAATCCAAGGCATCCTCGTCCCCTCCTCCGCCCGCGGCACCTTCACAACCCCCCTCCTAACCCTCAACACCGGC
GTCTTCCAAGCCATCGGCGTAATCTCCTTCGCCTTCGTCTGCCACCACAACTCCCTCCTCATCTACGGCTCCCTC
CGCACCCCAACAATCGACAACTTCTCCCGCGTAACCCACTACTCAACCACCGTCTCCATGCTGGCCTGCCTAACC
ATGGCCCTCGCCGGCTTCCTCACCTTCGGCGACAAGACAGCCGGCAACGTGCTCAACAACTTCCCCCCCTCCAAC
AACATGGTCAACCTCGCCCGCCTCTTCTTCGGCCTCAACATGCTCACCACGATGCCCCTCGAAGCCTTCGTCTGC
AGGGAAGTCATGCTAACCTACTGGTTCCCCCACTCCGCCTTCGACCTCGGACGACACGTGCTCCTCAGCACGGGC
CTCGTCCTCGCCGCCACGGCCCTCAGCCTGCTTACCTGCGACCTAGGCGTCGTCTTCGAGCTCGTCGGCGCCACT
AGCGCCGTCGTCATGGCCTACATCCTCCCTCCGCTCTGCTACGTCCGCCTCGCCTCGTCCAGTTGGCGCACCTAC
GTCGCCTACCTCATCGTCGTCTTTGGCGTCGCCGTCATGGCCATCAGTGTTTTGCAGGCTGGGGCTTCGCTGCTG
AGGGGCAGGGAGGCCGCTGCTTGTACATGA
Gene >Ophun1|3033
ATGCGTGACGACGAGGGCGTGCGGCTCGAGAGGGTTGTTTCGGGGGGCGAGGACGATGAGGAGGCTGCCATGGGC
CATCTCGAGACGCAGCCCATGCTATCCTCGTCCGCCAACGTCAACGACCACAACGACGACGACGATTCCCACGAT
GACGATGACGATGACGATGACGATGCCTCCGCTACAACCCCCCAACACCCCCCCCCAACCCNNTCGGCCTCACCC
TCGTCGTCGACTGGACCATCTGCCTCATCGTCATCAACAGCAAGCTCAGCGGCACCACCAGCTTCCAGGGCACCG
TCGAGCACTGCTTCGGCAGGCCCGGCATGGTGGCCATCAGTCTGGCCCAGTGGGTCTTCGCCTTTGGCGGCATGG
TGGCTTTTGCTGTCATTGTTGGCGATACCATCCCTCATGTTCTTACCGCCGTTTGGCCGGGGTTGGCTTCCGTTC
CGGTGCTGGGCCTCTTGACGGATAGACGGGTTGCCATTATCGTCTTCATCATGGGCGTCAGCTACCCACTAACAC
TCTACCGCGACATCGCCAAGGCAAGTTCTGTCCCCCCCCCCCCCCCAATCTCAACAACCCCAAACTAACAAAACC
AGCTGGCCAAAGCTAGCACCTTTGCCCTCATCGGCATGATCGTCATCGTCACCACCGTCCTAATCCAAGGCATCC
TCGTCCCCTCCTCCGCCCGCGGCACCTTCACAACCCCCCTCCTAACCCTCAACACCGGCGTCTTCCAAGCCATCG
GCGTAATCTCCTTCGGTAAACCCATGTTCCCTCCCCCCAAAGTCTTGCAGCAAACTAACAAAAGCCACACAGCCT
TCGTCTGCCACCACAACTCCCTCCTCATCTACGGCTCCCTCCGCACCCCAACAATCGACAACTTCTCCCGCGTAA
CCCACTACTCAACCACCGTCTCCATGCTGGCCTGCCTAACCATGGCCCTCGCCGGCTTCCTCACCTTCGGCGACA
AGACAGCCGGCAACGTGCTCAACAACTTCCCCCCCTCCAACAACATGGTCAACCTCGCCCGCCTCTTCTTCGGCC
TCAACATGCTCACCACGATGCCCCTCGAAGCCTTCGTCTGCAGGGAAGTCATGCTAACCTACTGGTTCCCCCACT
CCGCCTTCGACCTCGGACGACACGTGCTCCTCAGCACGGGCCTCGTCCTCGCCGCCACGGCCCTCAGCCTGCTTA
CCTGCGACCTAGGCGTCGTCTTCGAGCTCGTCGGCGCCACTAGCGCCGTCGTCATGGCCTACATCCTCCCTCCGC
TCTGCTACGTCCGCCTCGCCTCGTCCAGTTGGCGCACCTACGTCGCCTACCTCATCGTCGTCTTTGGCGTCGCCG
TCATGGCCATCAGTGTTTTGCAGGCTGGGGCTTCGCTGCTGAGGGGCAGGGAGGCCGCTGCTTGTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail