Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3020
Gene name
LocationContig_269:8342..9533
Strand+
Gene length (bp)1191
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02146 SIR2 Sir2 family 2.3E-30 58 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4P804|SIR4_BATDJ NAD-dependent protein deacylase SIR4 OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_20316 PE=3 SV=1 53 373 3.0E-61
sp|Q94AQ6|SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana GN=SRT2 PE=2 SV=1 50 350 1.0E-50
sp|Q89EA6|NPD2_BRADU NAD-dependent protein deacetylase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB2 PE=3 SV=2 55 355 4.0E-48
sp|A9UVV1|SIR4_MONBE NAD-dependent protein deacylase SIR4 OS=Monosiga brevicollis GN=15984 PE=3 SV=1 1 368 3.0E-44
sp|Q8R216|SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus GN=Sirt4 PE=1 SV=3 39 360 3.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4P804|SIR4_BATDJ NAD-dependent protein deacylase SIR4 OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_20316 PE=3 SV=1 53 373 3.0E-61
sp|Q94AQ6|SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana GN=SRT2 PE=2 SV=1 50 350 1.0E-50
sp|Q89EA6|NPD2_BRADU NAD-dependent protein deacetylase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB2 PE=3 SV=2 55 355 4.0E-48
sp|A9UVV1|SIR4_MONBE NAD-dependent protein deacylase SIR4 OS=Monosiga brevicollis GN=15984 PE=3 SV=1 1 368 3.0E-44
sp|Q8R216|SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus GN=Sirt4 PE=1 SV=3 39 360 3.0E-43
sp|Q8PDM9|NPD_XANCP NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cobB PE=3 SV=1 55 339 6.0E-43
sp|Q4UZX0|NPD_XANC8 NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cobB PE=3 SV=1 55 339 6.0E-43
sp|Q1JQC6|SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus GN=SIRT4 PE=2 SV=1 49 339 9.0E-43
sp|Q9RL35|NPD1_STRCO NAD-dependent protein deacetylase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB1 PE=3 SV=1 50 339 2.0E-42
sp|Q8PQK3|NPD_XANAC NAD-dependent protein deacetylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cobB PE=3 SV=2 55 340 3.0E-42
sp|Q9Y6E7|SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens GN=SIRT4 PE=1 SV=1 49 339 9.0E-42
sp|B0RM75|NPD_XANCB NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=cobB PE=3 SV=1 55 339 1.0E-41
sp|A0QDH4|NPD1_MYCA1 NAD-dependent protein deacetylase 1 OS=Mycobacterium avium (strain 104) GN=cobB1 PE=3 SV=1 55 339 7.0E-41
sp|Q8IRR5|SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster GN=Sirt4 PE=2 SV=2 52 339 4.0E-40
sp|Q7WLE5|NPD_BORBR NAD-dependent protein deacetylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cobB PE=3 SV=1 48 371 1.0E-39
sp|Q20480|SIR41_CAEEL NAD-dependent protein deacylase sir-2.2 OS=Caenorhabditis elegans GN=sir-2.2 PE=3 SV=1 23 339 1.0E-38
sp|Q8FUC8|NPD1_COREF NAD-dependent protein deacetylase 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cobB1 PE=3 SV=2 49 369 1.0E-38
sp|Q4QB33|SIR4_LEIMA NAD-dependent protein deacylase SIR2rp2 OS=Leishmania major GN=SIR2rp2 PE=3 SV=1 52 340 1.0E-38
sp|Q7VX46|NPD_BORPE NAD-dependent protein deacetylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cobB PE=3 SV=1 48 370 1.0E-38
sp|Q882K4|NPD3_PSESM NAD-dependent protein deacetylase 3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB3 PE=3 SV=1 54 373 2.0E-37
sp|Q57YZ9|SIR4_TRYB2 NAD-dependent protein deacylase SIR2rp2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=SIR2rp2 PE=3 SV=1 53 366 1.0E-35
sp|Q20481|SIR42_CAEEL NAD-dependent protein deacylase sir-2.3 OS=Caenorhabditis elegans GN=sir-2.3 PE=3 SV=1 11 340 2.0E-34
sp|B5YJW3|NPD_THEYD NAD-dependent protein deacetylase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cobB PE=3 SV=1 50 173 2.0E-20
sp|Q974M6|NPD_SULTO NAD-dependent protein deacetylase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cobB PE=3 SV=2 50 173 4.0E-20
sp|Q9WYW0|NPD_THEMA NAD-dependent protein deacetylase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cobB PE=1 SV=1 53 174 1.0E-19
sp|Q97VX5|NPD_SULSO NAD-dependent protein deacetylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cobB PE=1 SV=1 50 173 2.0E-18
sp|Q4JBN2|NPD_SULAC NAD-dependent protein deacetylase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cobB PE=3 SV=2 50 173 3.0E-18
sp|O30124|NPD2_ARCFU NAD-dependent protein deacylase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB2 PE=1 SV=1 50 178 5.0E-18
sp|Q89LY4|NPD1_BRADU NAD-dependent protein deacetylase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB1 PE=3 SV=1 54 174 2.0E-17
sp|Q5JG47|NPD_THEKO NAD-dependent protein deacylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cobB PE=3 SV=1 53 333 6.0E-17
sp|O58669|NPD_PYRHO NAD-dependent protein deacylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cobB PE=3 SV=1 50 208 2.0E-16
sp|Q8REC3|NPD_FUSNN NAD-dependent protein deacetylase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=cobB PE=3 SV=1 54 169 5.0E-16
sp|Q9UZE7|NPD_PYRAB NAD-dependent protein deacylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cobB PE=3 SV=1 50 333 5.0E-16
sp|Q8U1Q1|NPD_PYRFU NAD-dependent protein deacylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cobB PE=3 SV=2 50 333 6.0E-16
sp|Q8ZT00|NPD2_PYRAE NAD-dependent protein deacylase 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB2 PE=3 SV=1 50 173 7.0E-16
sp|Q8XNS6|NPD_CLOPE NAD-dependent protein deacetylase OS=Clostridium perfringens (strain 13 / Type A) GN=cobB PE=3 SV=1 50 177 9.0E-16
sp|O28597|NPD1_ARCFU NAD-dependent protein deacylase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB1 PE=1 SV=1 54 174 1.0E-15
sp|Q8CJM9|NPD2_STRCO NAD-dependent protein deacetylase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB2 PE=3 SV=1 55 169 2.0E-15
sp|E9GD30|SIR5_DAPPU NAD-dependent protein deacylase OS=Daphnia pulex GN=DAPPUDRAFT_195469 PE=3 SV=1 50 333 3.0E-15
sp|Q6N6U0|NPD_RHOPA NAD-dependent protein deacetylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cobB PE=3 SV=1 50 169 3.0E-15
sp|A8MBU4|NPD_CALMQ NAD-dependent protein deacetylase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=cobB PE=3 SV=1 50 173 5.0E-15
sp|Q68FX9|SIR5_RAT NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Rattus norvegicus GN=Sirt5 PE=2 SV=1 54 342 1.0E-14
sp|Q8ZU41|NPD1_PYRAE NAD-dependent protein deacetylase 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB1 PE=3 SV=1 50 174 3.0E-14
sp|Q8TWG0|NPD_METKA NAD-dependent protein deacylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=cobB PE=3 SV=1 54 175 4.0E-14
sp|Q8R984|NPD2_CALS4 NAD-dependent protein deacetylase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB2 PE=3 SV=1 50 184 5.0E-14
sp|Q97MB4|NPD_CLOAB NAD-dependent protein deacetylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cobB PE=3 SV=1 50 169 2.0E-13
sp|F7DKV7|SIR5_XENTR NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Xenopus tropicalis GN=sirt5 PE=3 SV=1 55 342 2.0E-13
sp|Q8BKJ9|SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus GN=Sirt7 PE=1 SV=2 5 175 2.0E-13
sp|B2RZ55|SIR7_RAT NAD-dependent protein deacetylase sirtuin-7 OS=Rattus norvegicus GN=Sirt7 PE=2 SV=1 5 175 3.0E-13
sp|Q5KZE8|NPD2_GEOKA NAD-dependent protein deacetylase 2 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB2 PE=3 SV=1 55 181 3.0E-13
sp|E1BRE2|SIR5_CHICK NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Gallus gallus GN=SIRT5 PE=3 SV=1 55 342 4.0E-13
sp|Q899G3|NPD_CLOTE NAD-dependent protein deacetylase OS=Clostridium tetani (strain Massachusetts / E88) GN=cobB PE=3 SV=1 50 181 6.0E-13
sp|C6A243|NPD_THESM NAD-dependent protein deacylase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=cobB PE=3 SV=1 54 314 8.0E-13
sp|Q5HZN8|SIR5A_XENLA NAD-dependent protein deacylase sirtuin-5A, mitochondrial OS=Xenopus laevis GN=sirt5-a PE=2 SV=1 55 342 1.0E-12
sp|Q73KE1|NPD_TREDE NAD-dependent protein deacetylase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=cobB PE=3 SV=1 54 332 2.0E-12
sp|Q8N6T7|SIR6_HUMAN NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens GN=SIRT6 PE=1 SV=2 50 175 2.0E-12
sp|Q8ELR0|NPD_OCEIH NAD-dependent protein deacetylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cobB PE=3 SV=1 50 174 2.0E-12
sp|Q6A5T5|NPD_PROAC NAD-dependent protein deacetylase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=cobB PE=3 SV=1 50 169 4.0E-12
sp|A9A0B2|NPD_DESOH NAD-dependent protein deacylase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=cobB PE=3 SV=1 50 192 4.0E-12
sp|Q5HM33|NPD_STAEQ NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cobB PE=3 SV=1 50 193 5.0E-12
sp|Q67KQ0|NPD_SYMTH NAD-dependent protein deacetylase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cobB PE=3 SV=1 50 178 5.0E-12
sp|Q8IE47|SIR5_PLAF7 NAD-dependent protein deacylase Sir2A OS=Plasmodium falciparum (isolate 3D7) GN=Sir2A PE=1 SV=1 53 333 7.0E-12
sp|Q5AI90|SIR5_CANAL NAD-dependent protein deacylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.10480 PE=3 SV=1 54 332 2.0E-11
sp|Q9YB13|NPD_AERPE NAD-dependent protein deacylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cobB PE=3 SV=2 50 172 2.0E-11
sp|Q3ZBQ0|SIR5_BOVIN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Bos taurus GN=SIRT5 PE=2 SV=1 54 333 2.0E-11
sp|Q9NRC8|SIR7_HUMAN NAD-dependent protein deacetylase sirtuin-7 OS=Homo sapiens GN=SIRT7 PE=1 SV=1 5 175 2.0E-11
sp|E2RDZ6|SIR5_CANLF NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Canis lupus familiaris GN=SIRT5 PE=3 SV=1 22 333 2.0E-11
sp|P59941|SIR6_MOUSE NAD-dependent protein deacetylase sirtuin-6 OS=Mus musculus GN=Sirt6 PE=1 SV=1 50 175 3.0E-11
sp|Q81BT4|NPD_BACCR NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cobB PE=3 SV=1 55 181 3.0E-11
sp|Q68F47|SIR5B_XENLA NAD-dependent protein deacylase sirtuin-5B, mitochondrial OS=Xenopus laevis GN=sirt5-b PE=2 SV=1 55 342 3.0E-11
sp|Q6HH09|NPD_BACHK NAD-dependent protein deacetylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cobB PE=3 SV=1 55 181 4.0E-11
sp|Q5L014|NPD1_GEOKA NAD-dependent protein deacetylase 1 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB1 PE=3 SV=1 50 169 5.0E-11
sp|Q5R6G3|SIR5_PONAB NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Pongo abelii GN=SIRT5 PE=2 SV=1 54 169 5.0E-11
sp|Q0P595|SIR7_BOVIN NAD-dependent protein deacetylase sirtuin-7 OS=Bos taurus GN=SIRT7 PE=2 SV=1 5 175 5.0E-11
sp|O67919|NPD_AQUAE NAD-dependent protein deacylase OS=Aquifex aeolicus (strain VF5) GN=cobB PE=3 SV=1 54 188 5.0E-11
sp|Q8CNF4|NPD_STAES NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cobB PE=3 SV=1 50 193 5.0E-11
sp|F7EZ75|SIR5_MACMU NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Macaca mulatta GN=SIRT5 PE=3 SV=1 54 169 6.0E-11
sp|Q9NXA8|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens GN=SIRT5 PE=1 SV=2 54 169 6.0E-11
sp|Q7P1B9|NPD_CHRVO NAD-dependent protein deacetylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cobB PE=3 SV=1 55 181 6.0E-11
sp|Q639M6|NPD_BACCZ NAD-dependent protein deacetylase OS=Bacillus cereus (strain ZK / E33L) GN=cobB PE=3 SV=1 55 181 7.0E-11
sp|Q735N7|NPD_BACC1 NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cobB PE=3 SV=1 54 181 1.0E-10
sp|Q95Q89|SIR24_CAEEL NAD-dependent protein deacetylase sir-2.4 OS=Caenorhabditis elegans GN=sir-2.4 PE=3 SV=2 55 176 2.0E-10
sp|Q81NT6|NPD_BACAN NAD-dependent protein deacetylase OS=Bacillus anthracis GN=cobB PE=3 SV=1 55 181 2.0E-10
sp|Q6DHI5|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio GN=sirt5 PE=1 SV=1 55 333 4.0E-10
sp|Q8K2C6|SIR5_MOUSE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Mus musculus GN=Sirt5 PE=1 SV=1 55 333 4.0E-10
sp|O07595|NPD_BACSU NAD-dependent protein deacetylase OS=Bacillus subtilis (strain 168) GN=cobB PE=3 SV=1 54 182 4.0E-10
sp|Q9I4E1|NPD2_PSEAE NAD-dependent protein deacylase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB2 PE=3 SV=1 54 190 5.0E-10
sp|Q9A2S6|NPD_CAUCR NAD-dependent protein deacylase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cobB PE=3 SV=1 55 173 1.0E-09
sp|Q9FE17|SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana GN=SRT1 PE=2 SV=1 50 175 2.0E-09
sp|Q73WM7|NPD_MYCPA NAD-dependent protein deacylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cobB PE=3 SV=1 55 177 4.0E-09
sp|Q55DB0|SIR2E_DICDI NAD-dependent deacetylase sir2E OS=Dictyostelium discoideum GN=sir2E PE=2 SV=2 54 173 4.0E-09
sp|Q9I7I7|SIRT2_DROME NAD-dependent protein deacetylase Sirt2 OS=Drosophila melanogaster GN=Sirt2 PE=3 SV=1 54 309 5.0E-09
sp|Q5WKC8|NPD_BACSK NAD-dependent protein deacetylase OS=Bacillus clausii (strain KSM-K16) GN=cobB PE=3 SV=1 54 181 6.0E-09
sp|Q8F3Z6|NPD_LEPIN NAD-dependent protein deacylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cobB PE=3 SV=1 56 180 8.0E-09
sp|Q72RR0|NPD_LEPIC NAD-dependent protein deacylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cobB PE=3 SV=1 56 180 8.0E-09
sp|A0QC96|NPD2_MYCA1 NAD-dependent protein deacylase 2 OS=Mycobacterium avium (strain 104) GN=cobB2 PE=3 SV=1 55 177 1.0E-08
sp|Q88BY5|NPD_PSEPK NAD-dependent protein deacylase OS=Pseudomonas putida (strain KT2440) GN=cobB PE=3 SV=1 50 169 1.0E-08
sp|A9SDL4|SIR5_PHYPA NAD-dependent protein deacylase OS=Physcomitrella patens subsp. patens GN=SRT1505 PE=3 SV=1 54 171 2.0E-08
sp|Q8R9N6|NPD1_CALS4 NAD-dependent protein deacylase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB1 PE=3 SV=1 50 169 2.0E-08
sp|Q885X7|NPD2_PSESM NAD-dependent protein deacylase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB2 PE=3 SV=1 54 184 3.0E-08
sp|C1DBX3|NPD_LARHH NAD-dependent protein deacetylase OS=Laribacter hongkongensis (strain HLHK9) GN=cobB PE=3 SV=1 54 169 3.0E-08
sp|Q9VH08|SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster GN=Sirt6 PE=2 SV=1 51 202 3.0E-08
sp|Q5SIH7|NPD_THET8 NAD-dependent protein deacylase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=cobB PE=3 SV=1 55 173 4.0E-08
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 54 184 4.0E-08
sp|Q9JN05|NPD_CAMJE NAD-dependent protein deacylase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cobB PE=3 SV=2 54 174 5.0E-08
sp|Q88ZA0|NPD_LACPL NAD-dependent protein deacetylase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cobB PE=3 SV=1 54 178 5.0E-08
sp|Q5HU51|NPD_CAMJR NAD-dependent protein deacylase OS=Campylobacter jejuni (strain RM1221) GN=cobB PE=3 SV=1 54 174 7.0E-08
sp|Q9KEE5|NPD_BACHD NAD-dependent protein deacetylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cobB PE=3 SV=1 54 173 9.0E-08
sp|Q9VAQ1|SIR7_DROME NAD-dependent protein deacetylase Sirt7 OS=Drosophila melanogaster GN=Sirt7 PE=1 SV=2 19 170 2.0E-07
sp|Q87W79|NPD4_PSESM NAD-dependent protein deacylase 4 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB4 PE=3 SV=1 54 169 2.0E-07
sp|Q9CBW6|NPD_MYCLE NAD-dependent protein deacylase OS=Mycobacterium leprae (strain TN) GN=cobB PE=3 SV=1 54 174 2.0E-07
sp|Q839C6|NPD_ENTFA NAD-dependent protein deacetylase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cobB PE=3 SV=1 56 169 4.0E-07
sp|Q9I4L0|NPD1_PSEAE NAD-dependent protein deacylase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB1 PE=3 SV=1 54 173 6.0E-07
sp|Q8EFN2|NPD_SHEON NAD-dependent protein deacylase OS=Shewanella oneidensis (strain MR-1) GN=cobB PE=3 SV=1 54 173 9.0E-07
sp|Q8A3H9|NPD_BACTN NAD-dependent protein deacylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cobB PE=3 SV=1 54 180 1.0E-06
sp|F7D4X9|SIR5_MONDO NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Monodelphis domestica GN=SIRT5 PE=3 SV=1 55 286 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0051287 NAD binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4166
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6257
Ophiocordyceps australis map64 (Brazil) OphauB2|6556
Ophiocordyceps camponoti-floridani Ophcf2|01932
Ophiocordyceps camponoti-rufipedis Ophun1|3020 (this protein)
Ophiocordyceps kimflemingae Ophio5|8434
Ophiocordyceps subramaniannii Hirsu2|8458

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3020
MAATRRPLIRIPYTDVLASPTVVPASARSLAGAVDALVAFFAAPPPPGLSSGAVVLSGAGLSVASGLADYRGVNG
TYRLNKTYRPIYYADFVANHEARKRYWARSFLGWSSLQAASPNAGHHAIGQLGEMGLIRSVITQNVDSLHQRAHP
RLPSLELHGYLRATVCVSCRSEYSRHLFQNHLARLNPRWADLLNRALASGALNTEDLAKRKARGLRFNPDGDVDL
PEAPYTTFRYPPCPRCLADPPLGPDGRPHMVNVDDDGAWAPSSTAGVLKPAVVMFGENIVEPVKRAAEEAIDGAG
KLLVVGTSLATYSAWRLARRAKERRMPVAIVNMGGVRGESEFFDNLDPLQTGEKAVRVELAIDQVLPALVSVLHK
GAIPTSAAAITQQNVFKDMLS*
Coding >Ophun1|3020
ATGGCCGCCACTCGCAGGCCTCTCATTCGAATTCCCTACACCGACGTCTTGGCCTCCCCCACCGTCGTACCCGCC
TCTGCTCGCTCGCTGGCCGGTGCTGTCGATGCTCTCGTCGCCTTCTTCGCCGCCCCGCCGCCCCCCGGTCTGTCC
TCCGGAGCCGTCGTGCTGTCCGGAGCCGGCCTCTCCGTCGCCTCCGGGTTGGCCGACTATCGGGGCGTCAATGGC
ACGTACCGCCTCAACAAGACCTATCGTCCAATTTACTACGCCGATTTCGTCGCCAATCACGAGGCTCGTAAGCGG
TATTGGGCCAGGAGCTTCCTCGGCTGGTCCAGCCTGCAGGCCGCGTCGCCCAACGCCGGCCACCATGCCATCGGC
CAGCTTGGAGAGATGGGCTTGATCCGCTCTGTCATCACTCAAAACGTTGATTCCCTTCATCAACGAGCTCACCCC
CGTCTGCCCTCTCTCGAGCTGCACGGCTATCTGAGGGCCACCGTCTGCGTTTCCTGTCGCTCCGAGTACTCGCGC
CACCTCTTCCAGAACCATCTGGCCCGTCTCAACCCTCGCTGGGCCGACCTGCTGAATCGCGCCTTGGCCTCGGGC
GCCCTCAACACTGAGGACCTCGCCAAACGCAAAGCTCGCGGCCTGCGCTTCAACCCGGACGGCGACGTCGACTTG
CCCGAGGCCCCATACACCACCTTCAGATACCCGCCGTGCCCCCGGTGCCTGGCCGATCCGCCCTTGGGCCCCGAC
GGCCGGCCGCACATGGTCAATGTCGATGACGACGGAGCATGGGCCCCATCCAGCACCGCCGGCGTCCTCAAACCG
GCCGTCGTCATGTTCGGCGAGAACATTGTTGAGCCAGTCAAGCGGGCTGCCGAGGAGGCCATCGATGGCGCCGGC
AAGCTGCTCGTTGTCGGCACATCGCTCGCCACCTACTCGGCCTGGAGACTGGCCAGGCGGGCCAAGGAGAGGCGC
ATGCCCGTTGCCATCGTCAACATGGGCGGGGTGAGAGGCGAGTCTGAATTCTTTGACAACCTCGATCCCCTTCAG
ACGGGTGAAAAGGCAGTCAGAGTCGAGCTCGCCATCGATCAGGTTCTACCGGCTCTCGTATCGGTTTTGCACAAG
GGTGCCATCCCCACTTCTGCCGCCGCCATCACGCAGCAAAACGTGTTCAAAGACATGCTCTCGTGA
Transcript >Ophun1|3020
ATGGCCGCCACTCGCAGGCCTCTCATTCGAATTCCCTACACCGACGTCTTGGCCTCCCCCACCGTCGTACCCGCC
TCTGCTCGCTCGCTGGCCGGTGCTGTCGATGCTCTCGTCGCCTTCTTCGCCGCCCCGCCGCCCCCCGGTCTGTCC
TCCGGAGCCGTCGTGCTGTCCGGAGCCGGCCTCTCCGTCGCCTCCGGGTTGGCCGACTATCGGGGCGTCAATGGC
ACGTACCGCCTCAACAAGACCTATCGTCCAATTTACTACGCCGATTTCGTCGCCAATCACGAGGCTCGTAAGCGG
TATTGGGCCAGGAGCTTCCTCGGCTGGTCCAGCCTGCAGGCCGCGTCGCCCAACGCCGGCCACCATGCCATCGGC
CAGCTTGGAGAGATGGGCTTGATCCGCTCTGTCATCACTCAAAACGTTGATTCCCTTCATCAACGAGCTCACCCC
CGTCTGCCCTCTCTCGAGCTGCACGGCTATCTGAGGGCCACCGTCTGCGTTTCCTGTCGCTCCGAGTACTCGCGC
CACCTCTTCCAGAACCATCTGGCCCGTCTCAACCCTCGCTGGGCCGACCTGCTGAATCGCGCCTTGGCCTCGGGC
GCCCTCAACACTGAGGACCTCGCCAAACGCAAAGCTCGCGGCCTGCGCTTCAACCCGGACGGCGACGTCGACTTG
CCCGAGGCCCCATACACCACCTTCAGATACCCGCCGTGCCCCCGGTGCCTGGCCGATCCGCCCTTGGGCCCCGAC
GGCCGGCCGCACATGGTCAATGTCGATGACGACGGAGCATGGGCCCCATCCAGCACCGCCGGCGTCCTCAAACCG
GCCGTCGTCATGTTCGGCGAGAACATTGTTGAGCCAGTCAAGCGGGCTGCCGAGGAGGCCATCGATGGCGCCGGC
AAGCTGCTCGTTGTCGGCACATCGCTCGCCACCTACTCGGCCTGGAGACTGGCCAGGCGGGCCAAGGAGAGGCGC
ATGCCCGTTGCCATCGTCAACATGGGCGGGGTGAGAGGCGAGTCTGAATTCTTTGACAACCTCGATCCCCTTCAG
ACGGGTGAAAAGGCAGTCAGAGTCGAGCTCGCCATCGATCAGGTTCTACCGGCTCTCGTATCGGTTTTGCACAAG
GGTGCCATCCCCACTTCTGCCGCCGCCATCACGCAGCAAAACGTGTTCAAAGACATGCTCTCGTGA
Gene >Ophun1|3020
ATGGCCGCCACTCGCAGGCCTCTCATTCGAATTCCCTACACCGACGTCTTGGCCTCCCCCACCGTCGTACCCGCC
TCTGCTCGCTCGCTGGCCGGTGCTGTCGATGCTCTCGTCGCCTTCTTCGCCGCCCCGCCGCCCCCCGGTCTGTCC
TCCGGAGCCGTCGTGCTGTCCGGAGCCGGCCTCTCCGTCGCCTCCGGGTTGGCCGACTATCGGGGCGTCAATGGC
ACGTACCGCCTCAACAAGACCTATCGTCCAATTTACTACGCCGATTTCGTCGCCAATCACGAGGCTCGTAAGCGG
TATTGGGCCAGGAGCTTCCTCGGCTGGTCCAGCCTGCAGGCCGCGTCGCCCAACGCCGGCCACCATGCCATCGGC
CAGCTTGGAGAGATGGGCTTGATCCGCTCTGTCATCACTCAAAACGTTGATTCCCTTCATCAACGAGCTCACCCC
CGTCTGCCCTCTCTCGAGCTGCACGGCTATCTGAGGGCCACCGTCTGCGTTTCCTGTCGCTCCGAGTACTCGCGC
CACCTCTTCCAGAACCATCTGGCCCGTCTCAACCCTCGCTGGGCCGACCTGCTGAATCGCGCCTTGGCCTCGGGC
GCCCTCAACACTGAGGACCTCGCCAAACGCAAAGCTCGCGGCCTGCGCTTCAACCCGGACGGCGACGTCGACTTG
CCCGAGGCCCCATACACCACCTTCAGATACCCGCCGTGCCCCCGGTGCCTGGCCGATCCGCCCTTGGGCCCCGAC
GGCCGGCCGCACATGGTCAATGTCGATGACGACGGAGCATGGGCCCCATCCAGCACCGCCGGCGTCCTCAAACCG
GCCGTCGTCATGTTCGGCGAGAACATTGTTGAGCCAGTCAAGCGGGCTGCCGAGGAGGCCATCGATGGCGCCGGC
AAGCTGCTCGTTGTCGGCACATCGCTCGCCACCTACTCGGCCTGGAGACTGGCCAGGCGGGCCAAGGAGAGGCGC
ATGCCCGTTGCCATCGTCAACATGGGCGGGGTGAGAGGCGAGTCTGAATTCTTTGACAACCTCGATCCCCTTCAG
ACGGGTGAAAAGGCAGTCAGAGTCGAGCTCGCCATCGATCAGGTTCTACCGGCTCTCGTATCGGTTTTGCACAAG
GGTGCCATCCCCACTTCTGCCGCCGCCATCACGCAGCAAAACGTGTTCAAAGACATGCTCTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail