Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|302
Gene name
LocationContig_108:11931..13277
Strand-
Gene length (bp)1346
Transcript length (bp)1221
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 3.0E-28 103 384

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 122 384 2.0E-43
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 12 384 1.0E-41
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 25 406 4.0E-40
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 77 384 1.0E-39
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 112 384 6.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 122 384 2.0E-43
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 12 384 1.0E-41
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 25 406 4.0E-40
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 77 384 1.0E-39
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 112 384 6.0E-39
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 119 384 9.0E-38
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 43 406 2.0E-37
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 66 384 2.0E-37
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 81 384 1.0E-36
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 80 384 4.0E-36
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 76 402 2.0E-35
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 33 384 7.0E-34
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 77 384 1.0E-32
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 40 389 2.0E-32
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 23 384 2.0E-32
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 40 384 8.0E-32
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 40 384 8.0E-31
sp|P30612|CP52P_CANTR Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 112 359 9.0E-31
sp|Q12585|CP52T_CANMA Cytochrome P450 52D1 OS=Candida maltosa GN=CYP52D1 PE=2 SV=1 77 362 5.0E-30
sp|Q12587|CP52Q_CANMA Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 42 402 1.0E-27
sp|P30611|CP52N_CANTR Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 112 384 3.0E-20
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 117 384 7.0E-18
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 123 384 7.0E-14
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 41 385 2.0E-13
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 40 384 1.0E-12
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 124 384 1.0E-12
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 114 385 2.0E-12
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 38 389 6.0E-12
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 105 384 9.0E-12
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 122 384 3.0E-11
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 124 384 4.0E-11
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 92 385 5.0E-11
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 124 384 1.0E-10
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 124 362 1.0E-10
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 122 384 2.0E-10
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 44 384 5.0E-10
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 122 384 7.0E-10
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 144 385 7.0E-10
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 122 385 7.0E-10
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 124 384 8.0E-10
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 122 389 2.0E-09
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 28 384 3.0E-09
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 105 384 3.0E-09
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 168 384 5.0E-09
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 122 384 5.0E-09
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 105 386 1.0E-08
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 144 385 1.0E-08
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 105 389 5.0E-08
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 41 384 8.0E-08
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 124 359 8.0E-08
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 161 389 1.0E-07
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 158 401 1.0E-07
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 158 384 1.0E-07
sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 110 384 2.0E-07
sp|P19099|C11B2_HUMAN Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 81 384 3.0E-07
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 105 384 4.0E-07
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 167 384 5.0E-07
sp|Q29527|C11B1_PAPHU Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 65 384 5.0E-07
sp|Q95M61|CP19A_CALJA Aromatase OS=Callithrix jacchus GN=CYP19A1 PE=2 SV=2 161 384 6.0E-07
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 92 389 6.0E-07
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 84 384 6.0E-07
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 105 385 9.0E-07
sp|P11511|CP19A_HUMAN Aromatase OS=Homo sapiens GN=CYP19A1 PE=1 SV=3 161 384 1.0E-06
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 65 384 1.0E-06
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 78 384 2.0E-06
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 158 384 2.0E-06
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 42 389 2.0E-06
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 158 384 3.0E-06
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 206 389 3.0E-06
sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 69 384 3.0E-06
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 57 384 4.0E-06
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 107 384 4.0E-06
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 84 384 5.0E-06
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 84 384 5.0E-06
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 168 389 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 28 21
2 38 55 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|302
MSREALYLGLSMASAGCLAYSVIQHLVVRVAGPSLLRSPWLMLILVIVLYLARSGHHEQRQMRLRGAAPGKMYPH
RDPIFGIDWMRLVLRAQSNNELIQVWHSLWTEEVGKTFWVNALGNWLLMTCEPENVRAILQGQFKSWPIEGVRKR
TTIAVIGSKSIFSSNGPQWAHTRAMMRPTFVRNQIADLECLDRHADNFLARLRLEGSKIDLQHLLYLFTMDTSTD
FMFGRSTEMLLRPSDDAVEFTNAFDYALRASTNRGRAGWLAFLMPDKKFDASVAICRAFIDRYIAAALKEDKPKE
RSYVFMHELIDSGATHEEISDQLLSMILGGRDTSASTLSSLFWMLARRPDVVGAIRKEVLQLQGNRPTWEQLKEL
KYLNNALKEGESTHLTSLSSSTRSADRTPKL*
Coding >Ophun1|302
ATGTCTCGGGAAGCACTCTATCTCGGCCTCTCCATGGCCTCGGCCGGCTGTTTGGCCTACTCGGTGATCCAGCAC
CTTGTCGTCCGCGTGGCCGGTCCGTCCCTGCTTCGTTCGCCATGGCTGATGCTCATCCTCGTCATCGTCCTGTAC
TTGGCCCGCTCTGGCCATCATGAGCAGCGTCAGATGCGTCTCCGGGGCGCAGCACCCGGCAAGATGTACCCTCAT
CGCGATCCGATCTTTGGGATCGACTGGATGCGGCTCGTGCTTCGGGCTCAGTCCAATAACGAGTTGATCCAGGTC
TGGCACAGCCTCTGGACCGAGGAGGTTGGCAAGACCTTTTGGGTCAACGCCTTGGGCAATTGGCTTCTCATGACT
TGCGAGCCCGAAAACGTCCGGGCCATCCTGCAGGGCCAATTCAAGTCGTGGCCCATCGAGGGCGTGCGGAAGCGA
ACCACGATAGCCGTCATAGGATCCAAGTCCATCTTCAGTAGCAACGGGCCCCAATGGGCTCACACGCGTGCCATG
ATGCGTCCGACCTTTGTTCGAAACCAGATCGCCGATCTTGAATGCCTTGACCGCCATGCCGACAACTTTCTGGCC
CGTCTGCGGCTCGAGGGCTCCAAGATCGATCTTCAGCATCTCTTGTACTTGTTCACCATGGACACGTCGACCGAT
TTCATGTTCGGCCGCTCGACCGAGATGCTGCTACGGCCGTCGGACGATGCCGTCGAGTTCACAAACGCCTTTGAC
TATGCCTTACGGGCCAGCACCAACCGCGGCCGTGCAGGCTGGCTGGCGTTCCTGATGCCGGACAAGAAGTTTGAT
GCTTCTGTCGCCATCTGTCGAGCCTTCATTGACCGTTATATCGCCGCCGCGCTCAAGGAGGACAAGCCAAAGGAG
AGGTCCTACGTCTTTATGCACGAGCTGATCGACTCGGGTGCTACCCATGAAGAGATCTCGGACCAGCTTCTATCC
ATGATTCTCGGCGGTCGTGATACGAGTGCAAGCACTCTAAGCTCCTTGTTCTGGATGCTGGCCCGTCGACCTGAT
GTGGTGGGTGCCATCCGGAAAGAAGTACTCCAACTGCAGGGAAACCGTCCGACGTGGGAGCAGCTCAAGGAGCTC
AAGTACTTGAACAACGCGCTCAAAGAAGGCGAGTCTACTCACTTGACGAGCCTCTCTTCAAGCACGCGATCCGCT
GACCGTACACCAAAGCTCTGA
Transcript >Ophun1|302
ATGTCTCGGGAAGCACTCTATCTCGGCCTCTCCATGGCCTCGGCCGGCTGTTTGGCCTACTCGGTGATCCAGCAC
CTTGTCGTCCGCGTGGCCGGTCCGTCCCTGCTTCGTTCGCCATGGCTGATGCTCATCCTCGTCATCGTCCTGTAC
TTGGCCCGCTCTGGCCATCATGAGCAGCGTCAGATGCGTCTCCGGGGCGCAGCACCCGGCAAGATGTACCCTCAT
CGCGATCCGATCTTTGGGATCGACTGGATGCGGCTCGTGCTTCGGGCTCAGTCCAATAACGAGTTGATCCAGGTC
TGGCACAGCCTCTGGACCGAGGAGGTTGGCAAGACCTTTTGGGTCAACGCCTTGGGCAATTGGCTTCTCATGACT
TGCGAGCCCGAAAACGTCCGGGCCATCCTGCAGGGCCAATTCAAGTCGTGGCCCATCGAGGGCGTGCGGAAGCGA
ACCACGATAGCCGTCATAGGATCCAAGTCCATCTTCAGTAGCAACGGGCCCCAATGGGCTCACACGCGTGCCATG
ATGCGTCCGACCTTTGTTCGAAACCAGATCGCCGATCTTGAATGCCTTGACCGCCATGCCGACAACTTTCTGGCC
CGTCTGCGGCTCGAGGGCTCCAAGATCGATCTTCAGCATCTCTTGTACTTGTTCACCATGGACACGTCGACCGAT
TTCATGTTCGGCCGCTCGACCGAGATGCTGCTACGGCCGTCGGACGATGCCGTCGAGTTCACAAACGCCTTTGAC
TATGCCTTACGGGCCAGCACCAACCGCGGCCGTGCAGGCTGGCTGGCGTTCCTGATGCCGGACAAGAAGTTTGAT
GCTTCTGTCGCCATCTGTCGAGCCTTCATTGACCGTTATATCGCCGCCGCGCTCAAGGAGGACAAGCCAAAGGAG
AGGTCCTACGTCTTTATGCACGAGCTGATCGACTCGGGTGCTACCCATGAAGAGATCTCGGACCAGCTTCTATCC
ATGATTCTCGGCGGTCGTGATACGAGTGCAAGCACTCTAAGCTCCTTGTTCTGGATGCTGGCCCGTCGACCTGAT
GTGGTGGGTGCCATCCGGAAAGAAGTACTCCAACTGCAGGGAAACCGTCCGACGTGGGAGCAGCTCAAGGAGCTC
AAGTACTTGAACAACGCGCTCAAAGAAGGCGAGTCTACTCACTTGACGAGCCTCTCTTCAAGCACGCGATCCGCT
GACCGTACACCAAAGCTCTGA
Gene >Ophun1|302
ATGTCTCGGGAAGCACTCTATCTCGGCCTCTCCATGGCCTCGGCCGGCTGTTTGGCCTACTCGGTGATCCAGCAC
CTTGTCGTCCGCGTGGCCGGTCCGTCCCTGCTTCGTTCGCCATGGCTGATGCTCATCCTCGTCATCGTCCTGTAC
TTGGCCCGCTCTGGCCATCATGAGCAGCGTCAGATGCGTCTCCGGGGCGCAGCACCCGGCAAGATGTACCCTCAT
CGCGATCCGATCTTTGGGATCGACTGGATGCGGCTCGTGCTTCGGGCTCAGTCCAATAACGAGTTGATCCAGGTC
TGGCACAGCCTCTGGACCGAGGAGGTTGGCAAGACCTTTTGGGTCAACGCCTTGGGCAATTGGCTTCTCATGACT
TGCGAGCCCGAAAACGTCCGGGCCATCCTGCAGGGCCAATTCAAGTCGTGGCCCATCGAGGGCGTGCGGAAGCGA
ACCACGATAGGTGACTTCAATCATCTTACGAATACCTAAAGTCGGTGTCATGCATACTCACAATCAAGGCCAGCC
GTCATAGGATCCAAGTCCATCTTCAGTAGCAACGGGCCCCAATGGGCTCACACGCGTGCCATGATGCGTCCGACC
TTTGTTCGAAACCAGATCGCCGATCTTGAATGCCTTGACCGCCATGCCGACAACTTTCTGGCCCGTCTGCGGCTC
GAGGGCTCCAAGATCGATCTTCAGCATCTCTTGTACTTGTTCACCATGGACACGTCGACCGATTTCATGTTAGCA
GCGCCTTGGCCCTCTGCCATGAGAACGACGCTGACGTCTGGTGCCCCTGTATCAGGTTCGGCCGCTCGACCGAGA
TGCTGCTACGGCCGTCGGACGATGCCGTCGAGTTCACAAACGCCTTTGACTATGCCTTACGGGCCAGCACCAACC
GCGGCCGTGCAGGCTGGCTGGCGTTCCTGATGCCGGACAAGAAGTTTGATGCTTCTGTCGCCATCTGTCGAGCCT
TCATTGACCGTTATATCGCCGCCGCGCTCAAGGAGGACAAGCCAAAGGAGAGGTCCTACGTCTTTATGCACGAGC
TGATCGACTCGGGTGCTACCCATGAAGAGATCTCGGACCAGCTTCTATCCATGATTCTCGGCGGTCGTGATACGA
GTGCAAGCACTCTAAGCTCCTTGTTCTGGATGCTGGCCCGTCGACCTGATGTGGTGGGTGCCATCCGGAAAGAAG
TACTCCAACTGCAGGGAAACCGTCCGACGTGGGAGCAGCTCAAGGAGCTCAAGTACTTGAACAACGCGCTCAAAG
AAGGCGAGTCTACTCACTTGACGAGCCTCTCTTCAAGCACGCGATCCGCTGACCGTACACCAAAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail