Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3012
Gene name
LocationContig_268:14459..20025
Strand+
Gene length (bp)5566
Transcript length (bp)5454
Coding sequence length (bp)5454
Protein length (aa) 1818

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.3E-06 1389 1458

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 1293 1501 3.0E-07
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 1390 1501 2.0E-06
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 1390 1462 3.0E-06
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 1391 1496 7.0E-06
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 1390 1462 9.0E-06

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2927
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7618
Ophiocordyceps australis map64 (Brazil) OphauB2|7198
Ophiocordyceps camponoti-floridani Ophcf2|06319
Ophiocordyceps camponoti-rufipedis Ophun1|3012 (this protein)
Ophiocordyceps kimflemingae Ophio5|955
Ophiocordyceps subramaniannii Hirsu2|4910

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3012
MPAATTSHHRHRRLAQLCEHWDIAPFETLAPLPPATPPPSFRTAADEQLAEDFLQRRAADGAHARPKGVIRQAFS
SAGLRKGKTWDPSDVLDGLTTWVANAGSPGVAEALAVKLVAAGVHLVDTQKQKGAGILIKRRTLEPHDVRVRLLR
LAVIAKNIQLAQVLLPYSDPAVLDACLPYAIRGGDGAMTELLLVQGASAAYSREGQDAFRQACTIHGHSQLVSLV
LRSVRHPEESWMSMAMCDAARAGCFDAVLLLSRSTADGNYNQAEALRSAVCSGRQDIVLAIIIGSNPPQRSALNK
ALHTIQRDSSLQPAIKFKLVEVLLCAGAGGVSASQTLEKYYQADFLDMAALLAKYGAAAEYEDAAVLKSAVARGE
MILVEAFLRLPGAISSATASTCVSLIAEDASFDQRHAILSLLLRQGANGQALDQMLVDAAKAGDAKSVDLLLTPF
FPAVSPRCSTNPNRHAVATVDYNLGEALCAAMLRADLHMTRKILSRQPSPATLAAVFPLTKQLPNEERCPMTELF
VQSSLPSACLENALVDAVNQCASERDVSLITLLLRYESEITFSHGTGLSSLIKEANLELLDPLMQNITPKTAAAH
LQDMMAVEDRSTRAHLAAMLLRAGADKGIDQVASTLLAVLAEDPVDLPFLTMLLEQGRADINVLDGAVINKAVAH
PNPEVLDVIINQGEPSTSSITRALRALMPLPSTEDKARKLETLLDRSTRRQDVNSMLVHEVKSISQSSMDWPSLS
SMKHLLEAGADPNAHNAAALCHAVIGAKTEVVGIMIRWRLSPTPTALGTALPHALRIADAAKRLDLTTSLVKAGV
FAEEAGRALYYAMANFPTDLSLIGVLAAAADPSDGEALVLSASMESSEAMDVILANCTSSADARSSAMELAVSAK
SKEARSKMCRSLLAAGVSNEAASNALLSAAHDADVGLCDMLVIHGAVMGRRGGQAVIEACRRGSAEVLQVLLKAF
PETDEDGQKMLRAAFQAATEVSDLNRRAVIFEQLLRKGLSGDLVDAQLYPAARYGEDGMAVLRVLLAAGANPNHN
DGECVFSTASCAFVAPLDLLLGLETEENHQKRATQPTLLRALGACWSLHRDARYHIVDSLFRAGLCPCDDVHQKL
NEAVNEEDVEERLVKLLLDHGASPFVDDGKTLKDAARKMATTLLALVLETKLAQERVEEAFCEAFSVDNFDNWFT
DAGLGTARLLVDKFNHGQTLSRALILVMKKSSTETRNLADAFFELLMARGPDVDYNGGELLQQAASKADRAWTRR
LLQCHPSAETVSCAFQRIFDTETSQEDVLDIFSMFGEYREGEIDLMAGQQGYEPMVKRAIDQYPRSTMVLKTLLD
AGFYHDQATRCQIYPETGEEEVATLLLWAIAQPQKRVSTSVIELLIQRGAKVNAESSTSRTTPLMLATQTRRPDV
VKSLVDHGADGDAIDRQGRTSLCLAANASGDVAVQLMTMLLAAEPCKDDGSLHNAARNLNLPAVTLLVEAGHDPD
FPSPLHGGRSALGEVCLYGSDAGEMTALRERAMLKVMGLLMSGNSDLTIKSNGMSFLQLCFEATDAVTTTRALLK
SGMWKHVNKAFNRITLGGYTYSPTMYISKVLGRSSVNDQLLEVLRASRATDMFYASEGPQPDGAVGLPEEVEAED
RARRARLTRIAIESEDFDMAMACKRQLAQVEQQIATQQDEADDRRRSDRHGHVLEAIQSRAQAMEAVATAAHQRR
LAEQRALAEVSIGSARAVAATELEAEDARRRKTLAWEPRRFGSSAGGFEVSVMEERGGGDGQKRLVLVDGLRRES
RLLEEKRAPVGYVMELD*
Coding >Ophun1|3012
ATGCCGGCCGCGACGACGTCTCATCACCGCCATCGACGCCTCGCCCAGCTGTGCGAGCACTGGGACATTGCGCCT
TTCGAGACACTCGCTCCTCTACCGCCCGCGACGCCACCGCCTTCGTTCCGCACCGCCGCAGATGAGCAGCTGGCA
GAGGATTTCCTGCAGCGGCGCGCCGCCGATGGCGCTCATGCCCGTCCCAAGGGTGTCATTCGTCAGGCCTTTTCC
TCGGCTGGTCTCCGCAAGGGGAAGACGTGGGATCCCAGCGATGTGCTCGACGGTCTGACCACTTGGGTGGCCAAT
GCTGGCTCTCCGGGCGTTGCTGAGGCTCTGGCTGTCAAGCTGGTTGCTGCTGGTGTTCATCTGGTTGACACGCAG
AAGCAAAAGGGTGCCGGAATCCTGATCAAGCGTCGGACTCTCGAGCCTCACGATGTCCGTGTTCGGCTGCTTCGT
CTCGCCGTCATCGCCAAGAATATTCAGCTGGCGCAGGTTCTGCTGCCGTACTCCGATCCCGCGGTTCTGGACGCC
TGCTTGCCCTACGCCATCCGCGGTGGCGACGGCGCCATGACGGAGCTGCTACTCGTTCAGGGCGCCAGTGCTGCC
TACAGCCGCGAGGGCCAGGACGCCTTTCGCCAGGCTTGCACTATTCACGGCCACTCGCAGCTCGTCAGCCTCGTT
CTCCGCTCTGTGCGTCATCCAGAGGAGTCGTGGATGTCCATGGCCATGTGCGACGCCGCCCGCGCCGGCTGCTTC
GACGCCGTCTTGCTTCTCAGCCGCTCCACTGCCGATGGAAACTACAACCAGGCCGAGGCGCTGCGGTCTGCGGTC
TGCTCGGGAAGACAAGATATTGTCCTGGCCATCATCATTGGGAGCAACCCGCCTCAGAGATCAGCTCTCAACAAG
GCTCTCCACACCATCCAACGCGACTCTTCTCTCCAGCCGGCCATCAAGTTCAAGCTCGTCGAAGTCCTCCTTTGC
GCCGGAGCCGGCGGCGTCAGTGCCTCGCAGACGCTCGAGAAGTATTATCAGGCCGACTTTCTCGACATGGCCGCC
TTGCTGGCCAAGTACGGAGCGGCCGCCGAGTACGAGGACGCGGCCGTGCTCAAGTCGGCTGTTGCTCGCGGAGAG
ATGATCCTTGTCGAGGCCTTTCTCCGTCTGCCCGGCGCCATCAGCTCAGCTACGGCTTCGACTTGCGTGTCTCTG
ATAGCAGAAGATGCATCTTTTGACCAGCGTCATGCCATTCTCAGTCTTCTGCTACGGCAAGGCGCCAATGGCCAA
GCTCTCGACCAGATGCTTGTCGACGCAGCAAAGGCAGGCGATGCCAAGTCGGTCGACCTGCTGCTCACCCCCTTC
TTTCCCGCCGTATCTCCGCGTTGCTCGACGAATCCCAACAGACACGCGGTAGCGACAGTCGACTACAACTTGGGC
GAAGCTCTCTGTGCCGCCATGCTTCGTGCCGATCTGCACATGACGCGCAAGATTCTGTCTCGACAGCCCTCACCA
GCAACCCTGGCGGCCGTGTTTCCGCTGACGAAACAGCTGCCAAACGAGGAGAGGTGTCCAATGACGGAGCTGTTT
GTCCAGAGTTCATTGCCCAGTGCGTGCCTCGAGAACGCTCTGGTCGACGCCGTTAACCAATGTGCTTCTGAAAGA
GACGTCTCTCTCATCACGCTGCTTTTGAGATATGAATCAGAAATCACCTTTAGCCACGGAACTGGCCTGTCCTCT
CTCATCAAAGAGGCCAATCTCGAGCTTCTGGATCCCTTGATGCAGAATATCACACCCAAGACGGCCGCAGCTCAT
CTGCAAGACATGATGGCCGTCGAGGATCGCTCGACGCGTGCTCACTTGGCAGCCATGCTGCTTCGTGCCGGAGCC
GACAAGGGGATCGACCAGGTCGCATCTACGCTGCTGGCAGTGTTGGCAGAGGACCCGGTCGATCTGCCGTTTTTG
ACCATGCTCCTCGAGCAGGGACGCGCAGACATTAATGTCCTGGACGGTGCCGTCATCAACAAAGCCGTCGCCCAC
CCGAACCCCGAAGTCCTCGATGTCATCATCAACCAAGGAGAGCCGTCAACGTCGTCCATCACCCGGGCTTTGAGG
GCGCTGATGCCGCTTCCGTCGACGGAAGATAAGGCGCGGAAGCTCGAAACCCTGCTGGACAGGTCGACCCGAAGG
CAAGACGTCAACTCGATGCTGGTACACGAGGTCAAGTCGATTTCTCAGAGCAGCATGGACTGGCCGTCTCTGTCG
AGTATGAAGCATCTGCTTGAAGCCGGAGCCGATCCGAACGCGCACAACGCGGCGGCTCTCTGCCATGCCGTCATC
GGGGCCAAGACAGAAGTGGTCGGCATCATGATCCGCTGGCGACTGTCCCCGACTCCGACGGCTCTGGGCACCGCG
CTGCCACACGCTCTGCGCATCGCGGACGCTGCTAAGCGGTTGGACCTGACGACGTCGTTGGTCAAAGCCGGCGTC
TTCGCCGAAGAAGCCGGACGGGCCCTGTACTACGCAATGGCCAACTTTCCAACCGACCTGTCTCTCATTGGCGTC
TTGGCTGCCGCCGCAGACCCCTCCGACGGCGAGGCGCTCGTCTTGTCCGCGTCGATGGAGTCGTCCGAGGCCATG
GACGTGATTCTCGCCAACTGCACTTCTTCCGCAGACGCTCGGAGCTCGGCTATGGAACTGGCTGTGTCGGCAAAG
AGCAAGGAAGCGCGGAGCAAGATGTGCCGAAGTCTTCTGGCTGCTGGCGTGTCGAACGAGGCTGCATCGAATGCT
CTCCTGTCCGCCGCTCACGACGCCGACGTCGGGCTGTGCGACATGCTCGTGATCCATGGCGCTGTGATGGGGAGG
CGTGGCGGCCAAGCCGTCATCGAAGCTTGCCGAAGGGGATCCGCCGAAGTTCTCCAAGTTCTCCTCAAGGCCTTT
CCCGAGACCGACGAGGATGGCCAGAAGATGCTGAGGGCGGCGTTCCAGGCCGCGACCGAGGTCAGCGACTTGAAC
AGGCGAGCCGTCATCTTTGAGCAACTCCTGAGAAAGGGACTCAGCGGAGACCTGGTTGACGCTCAGCTGTATCCG
GCGGCAAGGTACGGCGAGGACGGCATGGCTGTCTTGAGGGTTCTCTTGGCAGCAGGGGCGAATCCTAACCACAAT
GACGGAGAGTGCGTCTTTTCCACGGCCAGCTGTGCGTTTGTGGCCCCTCTCGACCTGCTACTTGGACTGGAGACC
GAAGAGAACCATCAGAAGAGAGCAACACAGCCGACACTGCTCAGGGCGCTTGGCGCATGTTGGAGCCTTCACCGC
GATGCTCGATATCACATCGTCGACAGCCTTTTTAGGGCCGGCTTATGCCCTTGCGATGATGTGCACCAGAAACTC
AACGAAGCAGTCAACGAGGAAGACGTCGAGGAGCGTCTGGTGAAGTTGCTTCTCGACCACGGCGCGTCTCCGTTC
GTTGATGATGGCAAGACGCTCAAGGATGCTGCTCGGAAAATGGCGACAACGCTTCTGGCCCTCGTTTTGGAGACG
AAACTGGCGCAGGAACGGGTCGAGGAGGCCTTTTGCGAGGCGTTTTCTGTGGACAACTTTGACAACTGGTTTACG
GATGCCGGGCTCGGGACTGCAAGACTGCTGGTGGACAAGTTCAACCATGGACAGACTCTTAGCCGAGCCTTGATT
CTGGTCATGAAGAAATCGTCGACGGAGACTCGGAACTTGGCTGACGCCTTCTTCGAGTTGCTGATGGCTCGTGGG
CCAGACGTCGACTACAACGGTGGAGAGCTTCTGCAGCAAGCCGCGTCCAAGGCGGACCGGGCTTGGACGAGGCGG
CTCCTACAATGCCATCCGTCAGCAGAGACGGTCTCGTGCGCATTTCAGCGCATCTTCGACACGGAAACCAGCCAG
GAGGACGTTCTGGACATCTTTAGCATGTTTGGCGAATACCGCGAGGGCGAGATTGATCTCATGGCCGGACAGCAG
GGCTACGAGCCGATGGTCAAGCGAGCCATCGACCAGTATCCGAGGTCAACCATGGTGCTCAAGACGCTGCTGGAC
GCGGGCTTCTATCACGACCAAGCAACGCGGTGCCAAATTTATCCCGAGACGGGGGAGGAGGAGGTGGCGACGCTA
CTGCTCTGGGCCATTGCCCAACCGCAGAAACGGGTCAGCACGTCGGTGATTGAGCTGCTGATCCAGCGGGGAGCC
AAGGTTAACGCCGAATCGAGCACGTCTCGGACGACTCCGTTGATGCTGGCCACGCAGACGAGACGACCTGACGTG
GTCAAGTCATTGGTCGATCACGGCGCCGATGGGGATGCCATCGACCGTCAGGGGCGGACTTCGCTCTGTTTAGCG
GCCAACGCCAGCGGAGACGTGGCCGTTCAGCTGATGACGATGTTGCTGGCGGCGGAACCTTGCAAGGACGACGGA
TCTCTTCACAACGCGGCCCGGAATCTCAACCTGCCGGCCGTGACGCTGCTCGTCGAGGCCGGTCACGATCCGGAC
TTTCCCAGCCCGCTCCATGGCGGTCGAAGCGCGCTGGGCGAGGTCTGCCTTTACGGGTCGGACGCGGGAGAGATG
ACGGCGTTGAGGGAGCGAGCCATGCTCAAGGTCATGGGCCTTCTGATGTCGGGCAACTCGGATCTGACGATCAAG
TCCAACGGCATGTCGTTTCTGCAGCTGTGCTTCGAGGCGACGGACGCAGTGACGACGACGCGGGCGCTGCTCAAG
AGCGGCATGTGGAAGCACGTCAACAAGGCCTTTAACCGGATCACGCTCGGAGGCTACACGTACTCGCCCACCATG
TACATCTCCAAGGTGCTGGGCCGGTCGAGCGTCAACGATCAGCTGCTGGAGGTGTTGCGGGCCAGCCGGGCGACG
GACATGTTCTACGCCAGCGAGGGTCCGCAGCCGGACGGGGCGGTCGGTCTCCCGGAAGAGGTCGAGGCCGAGGAC
CGGGCTCGGAGGGCTCGGCTGACGCGCATCGCCATCGAGTCGGAGGACTTTGACATGGCCATGGCTTGCAAGCGG
CAGCTGGCCCAGGTCGAGCAGCAGATTGCGACGCAGCAGGACGAAGCCGACGACCGACGTCGGAGCGACAGACAC
GGCCATGTGCTCGAAGCCATCCAGTCTCGCGCCCAGGCCATGGAGGCGGTGGCAACGGCAGCGCACCAGCGACGA
CTGGCCGAGCAACGCGCCCTGGCAGAGGTGTCCATCGGCAGCGCGCGGGCGGTAGCGGCGACGGAGCTCGAAGCC
GAAGACGCCCGTCGGCGCAAGACGCTTGCGTGGGAGCCTCGACGGTTCGGTAGCTCGGCTGGGGGGTTTGAGGTT
TCGGTCATGGAGGAGAGGGGGGGGGGGGATGGGCAGAAGCGGTTGGTGCTTGTTGATGGGTTGAGGAGGGAGTCG
AGGTTGTTGGAGGAGAAGAGGGCTCCTGTTGGGTATGTTATGGAGTTGGATTAG
Transcript >Ophun1|3012
ATGCCGGCCGCGACGACGTCTCATCACCGCCATCGACGCCTCGCCCAGCTGTGCGAGCACTGGGACATTGCGCCT
TTCGAGACACTCGCTCCTCTACCGCCCGCGACGCCACCGCCTTCGTTCCGCACCGCCGCAGATGAGCAGCTGGCA
GAGGATTTCCTGCAGCGGCGCGCCGCCGATGGCGCTCATGCCCGTCCCAAGGGTGTCATTCGTCAGGCCTTTTCC
TCGGCTGGTCTCCGCAAGGGGAAGACGTGGGATCCCAGCGATGTGCTCGACGGTCTGACCACTTGGGTGGCCAAT
GCTGGCTCTCCGGGCGTTGCTGAGGCTCTGGCTGTCAAGCTGGTTGCTGCTGGTGTTCATCTGGTTGACACGCAG
AAGCAAAAGGGTGCCGGAATCCTGATCAAGCGTCGGACTCTCGAGCCTCACGATGTCCGTGTTCGGCTGCTTCGT
CTCGCCGTCATCGCCAAGAATATTCAGCTGGCGCAGGTTCTGCTGCCGTACTCCGATCCCGCGGTTCTGGACGCC
TGCTTGCCCTACGCCATCCGCGGTGGCGACGGCGCCATGACGGAGCTGCTACTCGTTCAGGGCGCCAGTGCTGCC
TACAGCCGCGAGGGCCAGGACGCCTTTCGCCAGGCTTGCACTATTCACGGCCACTCGCAGCTCGTCAGCCTCGTT
CTCCGCTCTGTGCGTCATCCAGAGGAGTCGTGGATGTCCATGGCCATGTGCGACGCCGCCCGCGCCGGCTGCTTC
GACGCCGTCTTGCTTCTCAGCCGCTCCACTGCCGATGGAAACTACAACCAGGCCGAGGCGCTGCGGTCTGCGGTC
TGCTCGGGAAGACAAGATATTGTCCTGGCCATCATCATTGGGAGCAACCCGCCTCAGAGATCAGCTCTCAACAAG
GCTCTCCACACCATCCAACGCGACTCTTCTCTCCAGCCGGCCATCAAGTTCAAGCTCGTCGAAGTCCTCCTTTGC
GCCGGAGCCGGCGGCGTCAGTGCCTCGCAGACGCTCGAGAAGTATTATCAGGCCGACTTTCTCGACATGGCCGCC
TTGCTGGCCAAGTACGGAGCGGCCGCCGAGTACGAGGACGCGGCCGTGCTCAAGTCGGCTGTTGCTCGCGGAGAG
ATGATCCTTGTCGAGGCCTTTCTCCGTCTGCCCGGCGCCATCAGCTCAGCTACGGCTTCGACTTGCGTGTCTCTG
ATAGCAGAAGATGCATCTTTTGACCAGCGTCATGCCATTCTCAGTCTTCTGCTACGGCAAGGCGCCAATGGCCAA
GCTCTCGACCAGATGCTTGTCGACGCAGCAAAGGCAGGCGATGCCAAGTCGGTCGACCTGCTGCTCACCCCCTTC
TTTCCCGCCGTATCTCCGCGTTGCTCGACGAATCCCAACAGACACGCGGTAGCGACAGTCGACTACAACTTGGGC
GAAGCTCTCTGTGCCGCCATGCTTCGTGCCGATCTGCACATGACGCGCAAGATTCTGTCTCGACAGCCCTCACCA
GCAACCCTGGCGGCCGTGTTTCCGCTGACGAAACAGCTGCCAAACGAGGAGAGGTGTCCAATGACGGAGCTGTTT
GTCCAGAGTTCATTGCCCAGTGCGTGCCTCGAGAACGCTCTGGTCGACGCCGTTAACCAATGTGCTTCTGAAAGA
GACGTCTCTCTCATCACGCTGCTTTTGAGATATGAATCAGAAATCACCTTTAGCCACGGAACTGGCCTGTCCTCT
CTCATCAAAGAGGCCAATCTCGAGCTTCTGGATCCCTTGATGCAGAATATCACACCCAAGACGGCCGCAGCTCAT
CTGCAAGACATGATGGCCGTCGAGGATCGCTCGACGCGTGCTCACTTGGCAGCCATGCTGCTTCGTGCCGGAGCC
GACAAGGGGATCGACCAGGTCGCATCTACGCTGCTGGCAGTGTTGGCAGAGGACCCGGTCGATCTGCCGTTTTTG
ACCATGCTCCTCGAGCAGGGACGCGCAGACATTAATGTCCTGGACGGTGCCGTCATCAACAAAGCCGTCGCCCAC
CCGAACCCCGAAGTCCTCGATGTCATCATCAACCAAGGAGAGCCGTCAACGTCGTCCATCACCCGGGCTTTGAGG
GCGCTGATGCCGCTTCCGTCGACGGAAGATAAGGCGCGGAAGCTCGAAACCCTGCTGGACAGGTCGACCCGAAGG
CAAGACGTCAACTCGATGCTGGTACACGAGGTCAAGTCGATTTCTCAGAGCAGCATGGACTGGCCGTCTCTGTCG
AGTATGAAGCATCTGCTTGAAGCCGGAGCCGATCCGAACGCGCACAACGCGGCGGCTCTCTGCCATGCCGTCATC
GGGGCCAAGACAGAAGTGGTCGGCATCATGATCCGCTGGCGACTGTCCCCGACTCCGACGGCTCTGGGCACCGCG
CTGCCACACGCTCTGCGCATCGCGGACGCTGCTAAGCGGTTGGACCTGACGACGTCGTTGGTCAAAGCCGGCGTC
TTCGCCGAAGAAGCCGGACGGGCCCTGTACTACGCAATGGCCAACTTTCCAACCGACCTGTCTCTCATTGGCGTC
TTGGCTGCCGCCGCAGACCCCTCCGACGGCGAGGCGCTCGTCTTGTCCGCGTCGATGGAGTCGTCCGAGGCCATG
GACGTGATTCTCGCCAACTGCACTTCTTCCGCAGACGCTCGGAGCTCGGCTATGGAACTGGCTGTGTCGGCAAAG
AGCAAGGAAGCGCGGAGCAAGATGTGCCGAAGTCTTCTGGCTGCTGGCGTGTCGAACGAGGCTGCATCGAATGCT
CTCCTGTCCGCCGCTCACGACGCCGACGTCGGGCTGTGCGACATGCTCGTGATCCATGGCGCTGTGATGGGGAGG
CGTGGCGGCCAAGCCGTCATCGAAGCTTGCCGAAGGGGATCCGCCGAAGTTCTCCAAGTTCTCCTCAAGGCCTTT
CCCGAGACCGACGAGGATGGCCAGAAGATGCTGAGGGCGGCGTTCCAGGCCGCGACCGAGGTCAGCGACTTGAAC
AGGCGAGCCGTCATCTTTGAGCAACTCCTGAGAAAGGGACTCAGCGGAGACCTGGTTGACGCTCAGCTGTATCCG
GCGGCAAGGTACGGCGAGGACGGCATGGCTGTCTTGAGGGTTCTCTTGGCAGCAGGGGCGAATCCTAACCACAAT
GACGGAGAGTGCGTCTTTTCCACGGCCAGCTGTGCGTTTGTGGCCCCTCTCGACCTGCTACTTGGACTGGAGACC
GAAGAGAACCATCAGAAGAGAGCAACACAGCCGACACTGCTCAGGGCGCTTGGCGCATGTTGGAGCCTTCACCGC
GATGCTCGATATCACATCGTCGACAGCCTTTTTAGGGCCGGCTTATGCCCTTGCGATGATGTGCACCAGAAACTC
AACGAAGCAGTCAACGAGGAAGACGTCGAGGAGCGTCTGGTGAAGTTGCTTCTCGACCACGGCGCGTCTCCGTTC
GTTGATGATGGCAAGACGCTCAAGGATGCTGCTCGGAAAATGGCGACAACGCTTCTGGCCCTCGTTTTGGAGACG
AAACTGGCGCAGGAACGGGTCGAGGAGGCCTTTTGCGAGGCGTTTTCTGTGGACAACTTTGACAACTGGTTTACG
GATGCCGGGCTCGGGACTGCAAGACTGCTGGTGGACAAGTTCAACCATGGACAGACTCTTAGCCGAGCCTTGATT
CTGGTCATGAAGAAATCGTCGACGGAGACTCGGAACTTGGCTGACGCCTTCTTCGAGTTGCTGATGGCTCGTGGG
CCAGACGTCGACTACAACGGTGGAGAGCTTCTGCAGCAAGCCGCGTCCAAGGCGGACCGGGCTTGGACGAGGCGG
CTCCTACAATGCCATCCGTCAGCAGAGACGGTCTCGTGCGCATTTCAGCGCATCTTCGACACGGAAACCAGCCAG
GAGGACGTTCTGGACATCTTTAGCATGTTTGGCGAATACCGCGAGGGCGAGATTGATCTCATGGCCGGACAGCAG
GGCTACGAGCCGATGGTCAAGCGAGCCATCGACCAGTATCCGAGGTCAACCATGGTGCTCAAGACGCTGCTGGAC
GCGGGCTTCTATCACGACCAAGCAACGCGGTGCCAAATTTATCCCGAGACGGGGGAGGAGGAGGTGGCGACGCTA
CTGCTCTGGGCCATTGCCCAACCGCAGAAACGGGTCAGCACGTCGGTGATTGAGCTGCTGATCCAGCGGGGAGCC
AAGGTTAACGCCGAATCGAGCACGTCTCGGACGACTCCGTTGATGCTGGCCACGCAGACGAGACGACCTGACGTG
GTCAAGTCATTGGTCGATCACGGCGCCGATGGGGATGCCATCGACCGTCAGGGGCGGACTTCGCTCTGTTTAGCG
GCCAACGCCAGCGGAGACGTGGCCGTTCAGCTGATGACGATGTTGCTGGCGGCGGAACCTTGCAAGGACGACGGA
TCTCTTCACAACGCGGCCCGGAATCTCAACCTGCCGGCCGTGACGCTGCTCGTCGAGGCCGGTCACGATCCGGAC
TTTCCCAGCCCGCTCCATGGCGGTCGAAGCGCGCTGGGCGAGGTCTGCCTTTACGGGTCGGACGCGGGAGAGATG
ACGGCGTTGAGGGAGCGAGCCATGCTCAAGGTCATGGGCCTTCTGATGTCGGGCAACTCGGATCTGACGATCAAG
TCCAACGGCATGTCGTTTCTGCAGCTGTGCTTCGAGGCGACGGACGCAGTGACGACGACGCGGGCGCTGCTCAAG
AGCGGCATGTGGAAGCACGTCAACAAGGCCTTTAACCGGATCACGCTCGGAGGCTACACGTACTCGCCCACCATG
TACATCTCCAAGGTGCTGGGCCGGTCGAGCGTCAACGATCAGCTGCTGGAGGTGTTGCGGGCCAGCCGGGCGACG
GACATGTTCTACGCCAGCGAGGGTCCGCAGCCGGACGGGGCGGTCGGTCTCCCGGAAGAGGTCGAGGCCGAGGAC
CGGGCTCGGAGGGCTCGGCTGACGCGCATCGCCATCGAGTCGGAGGACTTTGACATGGCCATGGCTTGCAAGCGG
CAGCTGGCCCAGGTCGAGCAGCAGATTGCGACGCAGCAGGACGAAGCCGACGACCGACGTCGGAGCGACAGACAC
GGCCATGTGCTCGAAGCCATCCAGTCTCGCGCCCAGGCCATGGAGGCGGTGGCAACGGCAGCGCACCAGCGACGA
CTGGCCGAGCAACGCGCCCTGGCAGAGGTGTCCATCGGCAGCGCGCGGGCGGTAGCGGCGACGGAGCTCGAAGCC
GAAGACGCCCGTCGGCGCAAGACGCTTGCGTGGGAGCCTCGACGGTTCGGTAGCTCGGCTGGGGGGTTTGAGGTT
TCGGTCATGGAGGAGAGGGGGGGGGGGGATGGGCAGAAGCGGTTGGTGCTTGTTGATGGGTTGAGGAGGGAGTCG
AGGTTGTTGGAGGAGAAGAGGGCTCCTGTTGGGTATGTTATGGAGTTGGATTAG
Gene >Ophun1|3012
ATGCCGGCCGCGACGACGTCTCATCACCGCCATCGACGCCTCGCCCAGCTGTGCGAGCACTGGGACATTGCGCCT
TTCGAGACACTCGCTCCTCTACCGCCCGCGACGCCACCGCCTTCGTTCCGCACCGCCGCAGATGAGCAGCTGGCA
GAGGATTTCCTGCAGCGGCGCGCCGCCGATGGCGCTCATGCCCGTCCCAAGGGTGTCATTCGTCAGGCCTTTTCC
TCGGCTGGTCTCCGCAAGGGGAAGACGTGGGATCCCAGCGATGTGCTCGACGGTCTGACCACTTGGGTGGCCAAT
GCTGGCTCTCCGGGCGTTGCTGAGGCTCTGGCTGTCAAGCTGGTTGCTGCTGGTGTTCATCTGGTTGACACGCAG
AAGCAAAAGGGTGCCGGAATCCTGATCAAGCGTCGGACTCTCGAGCCTCACGATGTCCGTGTTCGGCTGCTTCGT
CTCGCCGTCATCGCCAAGAATATTCAGCTGGCGCAGGTTCTGCTGCCGTACTCCGATCCCGCGGTTCTGGACGCC
TGCTTGCCCTACGCCATCCGCGGTGGCGACGGCGCCATGACGGAGCTGCTACTCGTTCAGGGCGCCAGTGCTGCC
TACAGCCGCGAGGGCCAGGACGCCTTTCGCCAGGCTTGCACTATTCACGGCCACTCGCAGCTCGTCAGCCTCGTT
CTCCGCTCTGTGCGTCATCCAGAGGAGTCGTGGATGTCCATGGCCATGTGCGACGCCGCCCGCGCCGGCTGCTTC
GACGCCGTCTTGCTTCTCAGCCGCTCCACTGCCGATGGAAACTACAACCAGGCCGAGGCGCTGCGGTCTGCGGTC
TGCTCGGGAAGACAAGATATTGTCCTGGCCATCATCATTGGGAGCAACCCGCCTCAGAGATCAGCTCTCAACAAG
GCTCTCCACACCATCCAACGCGACTCTTCTCTCCAGCCGGCCATCAAGTTCAAGCTCGTCGAAGTCCTCCTTTGC
GCCGGAGCCGGCGGCGTCAGTGCCTCGCAGACGCTCGAGAAGTATTATCAGGCCGACTTTCTCGACATGGCCGCC
TTGCTGGCCAAGTACGGAGCGGCCGCCGAGTACGAGGACGCGGCCGTGCTCAAGTCGGCTGTTGCTCGCGGAGAG
ATGATCCTTGTCGAGGCCTTTCTCCGTCTGCCCGGCGCCATCAGCTCAGCTACGGCTTCGACTTGCGTGTCTCTG
ATAGCAGAAGATGCATCTTTTGACCAGCGTCATGCCATTCTCAGTCTTCTGCTACGGCAAGGCGCCAATGGCCAA
GCTCTCGACCAGATGCTTGTCGACGCAGCAAAGGCAGGCGATGCCAAGTCGGTCGACCTGCTGCTCACCCCCTTC
TTTCCCGCCGTATCTCCGCGTTGCTCGACGAATCCCAACAGACACGCGGTAGCGACAGTCGACTACAACTTGGGC
GAAGCTCTCTGTGCCGCCATGCTTCGTGCCGATCTGCACATGACGCGCAAGATTCTGTCTCGACAGCCCTCACCA
GCAACCCTGGCGGCCGTGTTTCCGCTGACGAAACAGCTGCCAAACGAGGAGAGGTGTCCAATGACGGAGCTGTTT
GTCCAGAGTTCATTGCCCAGTGCGTGCCTCGAGAACGCTCTGGTCGACGCCGTTAACCAATGTGCTTCTGAAAGA
GACGTCTCTCTCATCACGCTGCTTTTGAGATATGAATCAGAAATCACCTTTAGCCACGGAACTGGCCTGTCCTCT
CTCATCAAAGAGGCCAATCTCGAGCTTCTGGATCCCTTGATGCAGAATATCACACCCAAGACGGCCGCAGCTCAT
CTGCAAGACATGATGGCCGTCGAGGATCGCTCGACGCGTGCTCACTTGGCAGCCATGCTGCTTCGTGCCGGAGCC
GACAAGGGGATCGACCAGGTCGCATCTACGCTGCTGGCAGTGTTGGCAGAGGACCCGGTCGATCTGCCGTTTTTG
ACCATGCTCCTCGAGCAGGGACGCGCAGACATTAATGTCCTGGACGGTGCCGTCATCAACAAAGCCGTCGCCCAC
CCGAACCCCGAAGTCCTCGATGTCATCATCAACCAAGGAGAGCCGTCAACGTCGTCCATCACCCGGGCTTTGAGG
GCGCTGATGCCGCTTCCGTCGACGGAAGATAAGGCGCGGAAGCTCGAAACCCTGCTGGACAGGTCGACCCGAAGG
CAAGACGTCAACTCGATGCTGGTACACGAGGTCAAGTCGATTTCTCAGAGCAGCATGGACTGGCCGTCTCTGTCG
AGTATGAAGCATCTGCTTGAAGCCGGAGCCGATCCGAACGCGCACAACGCGGCGGCTCTCTGCCATGCCGTCATC
GGGGCCAAGACAGAAGTGGTCGGCATCATGATCCGCTGGCGACTGTCCCCGACTCCGACGGCTCTGGGCACCGCG
CTGCCACACGCTCTGCGCATCGCGGACGCTGCTAAGCGGTTGGACCTGACGACGTCGTTGGTCAAAGCCGGCGTC
TTCGCCGAAGAAGCCGGACGGGCCCTGTACTACGCAATGGCCAACTTTCCAACCGACCTGTCTCTCATTGGCGTC
TTGGCTGCCGCCGCAGACCCCTCCGACGGCGAGGCGCTCGTCTTGTCCGCGTCGATGGAGTCGTCCGAGGCCATG
GACGTGATTCTCGCCAACTGCACTTCTTCCGCAGACGCTCGGAGCTCGGCTATGGAACTGGCTGTGTCGGCAAAG
AGCAAGGAAGCGCGGAGCAAGATGTGCCGAAGTCTTCTGGCTGCTGGCGTGTCGAACGAGGCTGCATCGAATGCT
CTCCTGTCCGCCGCTCACGACGCCGACGTCGGGCTGTGCGACATGCTCGTGATCCATGGCGCTGTGATGGGGAGG
CGTGGCGGCCAAGCCGTCATCGAAGCTTGCCGAAGGGGATCCGCCGAAGTTCTCCAAGTTCTCCTCAAGGCCTTT
CCCGAGACCGACGAGGATGGCCAGAAGATGCTGAGGGCGGCGTTCCAGGCCGCGACCGAGGTCAGCGACTTGAAC
AGGCGAGCCGTCATCTTTGAGCAACTCCTGAGAAAGGGACTCAGCGGAGACCTGGTTGACGCTCAGCTGTATCCG
GCGGCAAGGTACGGCGAGGACGGCATGGCTGTCTTGAGGGTTCTCTTGGCAGCAGGGGCGAATCCTAACCACAAT
GACGGAGAGTGCGTCTTTTCCACGGCCAGCTGTGCGTTTGTGGCCCCTCTCGACCTGCTACTTGGACTGGAGACC
GAAGAGAACCATCAGGTGAGATACTTGGAGACCCCATTGTGACGAAGCCGTTCTGACATGACACCCCCAGAAGAG
AGCAACACAGCCGACACTGCTCAGGGCGCTTGGCGCATGTTGGAGCCTTCACCGCGATGCTCGATATCACATCGT
CGACAGCCTTTTTAGGGCCGGCTTATGCCCTTGCGATGATGTGCACCAGAAACTCAACGAAGCAGTCAACGAGGA
AGACGTCGAGGAGCGTCTGGTGAAGTTGCTTCTCGACCACGGCGCGTCTCCGTTCGTTGATGATGGCAAGACGCT
CAAGGATGCTGCTCGGAAAATGGCGACAACGCTTCTGGCCCTCGTTTTGGAGACGAAACTGGCGCAGGAACGGGT
CGAGGAGGCCTTTTGCGAGGCGTTTTCTGTGGACAACTTTGACAACTGGTTTACGGATGCCGGGCTCGGGACTGC
AAGACTGCTGGTGGACAAGTTCAACCATGGACAGACTCTTAGCCGAGCCTTGATTCTGGTCATGAAGAAATCGTC
GACGGAGACTCGGAACTTGGCTGACGCCTTCTTCGAGTTGCTGATGGCTCGTGGGCCAGACGTCGACTACAACGG
TGGAGAGCTTCTGCAGCAAGCCGCGTCCAAGGCGGACCGGGCTTGGACGAGGCGGCTCCTACAATGCCATCCGTC
AGCAGAGACGGTCTCGTGCGCATTTCAGCGCATCTTCGACACGGAAACCAGCCAGGAGGACGTTCTGGACATCTT
TAGCATGTTTGGCGAATACCGCGAGGGCGAGATTGATCTCATGGCCGGACAGCAGGGCTACGAGCCGATGGTCAA
GCGAGCCATCGACCAGTATCCGAGGTCAACCATGGTGCTCAAGACGCTGCTGGACGCGGGCTTCTATCACGACCA
AGCAACGCGGTGCCAAATTTATCCCGAGACGGGGGAGGAGGAGGTGGCGACGCTACTGCTCTGGGCCATTGCCCA
ACCGCAGAAACGGGTCAGCACGTCGGTGATTGAGCTGCTGATCCAGCGGGGAGGTGAGTGATGAGCCTATGGTTC
CGAAACAAGGAGTTATTTACTAACAGGTTGTGAAGCCAAGGTTAACGCCGAATCGAGCACGTCTCGGACGACTCC
GTTGATGCTGGCCACGCAGACGAGACGACCTGACGTGGTCAAGTCATTGGTCGATCACGGCGCCGATGGGGATGC
CATCGACCGTCAGGGGCGGACTTCGCTCTGTTTAGCGGCCAACGCCAGCGGAGACGTGGCCGTTCAGCTGATGAC
GATGTTGCTGGCGGCGGAACCTTGCAAGGACGACGGATCTCTTCACAACGCGGCCCGGAATCTCAACCTGCCGGC
CGTGACGCTGCTCGTCGAGGCCGGTCACGATCCGGACTTTCCCAGCCCGCTCCATGGCGGTCGAAGCGCGCTGGG
CGAGGTCTGCCTTTACGGGTCGGACGCGGGAGAGATGACGGCGTTGAGGGAGCGAGCCATGCTCAAGGTCATGGG
CCTTCTGATGTCGGGCAACTCGGATCTGACGATCAAGTCCAACGGCATGTCGTTTCTGCAGCTGTGCTTCGAGGC
GACGGACGCAGTGACGACGACGCGGGCGCTGCTCAAGAGCGGCATGTGGAAGCACGTCAACAAGGCCTTTAACCG
GATCACGCTCGGAGGCTACACGTACTCGCCCACCATGTACATCTCCAAGGTGCTGGGCCGGTCGAGCGTCAACGA
TCAGCTGCTGGAGGTGTTGCGGGCCAGCCGGGCGACGGACATGTTCTACGCCAGCGAGGGTCCGCAGCCGGACGG
GGCGGTCGGTCTCCCGGAAGAGGTCGAGGCCGAGGACCGGGCTCGGAGGGCTCGGCTGACGCGCATCGCCATCGA
GTCGGAGGACTTTGACATGGCCATGGCTTGCAAGCGGCAGCTGGCCCAGGTCGAGCAGCAGATTGCGACGCAGCA
GGACGAAGCCGACGACCGACGTCGGAGCGACAGACACGGCCATGTGCTCGAAGCCATCCAGTCTCGCGCCCAGGC
CATGGAGGCGGTGGCAACGGCAGCGCACCAGCGACGACTGGCCGAGCAACGCGCCCTGGCAGAGGTGTCCATCGG
CAGCGCGCGGGCGGTAGCGGCGACGGAGCTCGAAGCCGAAGACGCCCGTCGGCGCAAGACGCTTGCGTGGGAGCC
TCGACGGTTCGGTAGCTCGGCTGGGGGGTTTGAGGTTTCGGTCATGGAGGAGAGGGGGGGGGGGGATGGGCAGAA
GCGGTTGGTGCTTGTTGATGGGTTGAGGAGGGAGTCGAGGTTGTTGGAGGAGAAGAGGGCTCCTGTTGGGTATGT
TATGGAGTTGGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail