Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3004
Gene name
LocationContig_267:14188..15070
Strand+
Gene length (bp)882
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07962 Swi3 Replication Fork Protection Component Swi3 2.1E-25 66 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RCW0|CSM3_MAGO7 Chromosome segregation in meiosis protein 3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CSM3 PE=3 SV=1 1 270 3.0E-50
sp|Q7SHE8|CSM3_NEUCR Chromosome segregation in meiosis protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csm-3 PE=3 SV=1 20 292 2.0E-44
sp|Q2H3R6|CSM3_CHAGB Chromosome segregation in meiosis protein 3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CSM3 PE=3 SV=1 24 221 4.0E-40
sp|Q0CU66|CSM3_ASPTN Chromosome segregation in meiosis protein 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=csm3 PE=3 SV=2 14 207 1.0E-35
sp|A1D9E6|CSM3_NEOFI Chromosome segregation in meiosis protein 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=csm3 PE=3 SV=1 30 272 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RCW0|CSM3_MAGO7 Chromosome segregation in meiosis protein 3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CSM3 PE=3 SV=1 1 270 3.0E-50
sp|Q7SHE8|CSM3_NEUCR Chromosome segregation in meiosis protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csm-3 PE=3 SV=1 20 292 2.0E-44
sp|Q2H3R6|CSM3_CHAGB Chromosome segregation in meiosis protein 3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CSM3 PE=3 SV=1 24 221 4.0E-40
sp|Q0CU66|CSM3_ASPTN Chromosome segregation in meiosis protein 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=csm3 PE=3 SV=2 14 207 1.0E-35
sp|A1D9E6|CSM3_NEOFI Chromosome segregation in meiosis protein 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=csm3 PE=3 SV=1 30 272 1.0E-33
sp|Q0UJ25|CSM3_PHANO Chromosome segregation in meiosis protein 3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CSM3 PE=3 SV=1 48 161 4.0E-32
sp|Q1DME8|CSM3_COCIM Chromosome segregation in meiosis protein 3 OS=Coccidioides immitis (strain RS) GN=CSM3 PE=3 SV=2 48 270 6.0E-32
sp|A4DA84|CSM3_ASPFU Chromosome segregation in meiosis protein 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csm3 PE=3 SV=1 6 272 7.0E-32
sp|A1C8Y9|CSM3_ASPCL Chromosome segregation in meiosis protein 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=csm3 PE=3 SV=1 24 272 5.0E-30
sp|O14350|SWI3_SCHPO Swi1-interacting protein swi3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swi3 PE=1 SV=2 48 146 5.0E-17
sp|Q6C656|CSM3_YARLI Chromosome segregation in meiosis protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CSM3 PE=3 SV=1 48 213 5.0E-16
sp|Q3ZCC4|TIPIN_BOVIN TIMELESS-interacting protein OS=Bos taurus GN=TIPIN PE=2 SV=1 66 174 2.0E-08
sp|Q6CIH2|CSM3_KLULA Chromosome segregation in meiosis protein 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CSM3 PE=3 SV=1 56 144 2.0E-08
sp|Q6FU57|CSM3_CANGA Chromosome segregation in meiosis protein 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CSM3 PE=3 SV=1 47 142 4.0E-08
sp|Q91WA1|TIPIN_MOUSE TIMELESS-interacting protein OS=Mus musculus GN=Tipin PE=1 SV=2 66 174 5.0E-08
sp|Q5F416|TIPIN_CHICK TIMELESS-interacting protein OS=Gallus gallus GN=TIPIN PE=2 SV=1 66 134 9.0E-08
sp|Q4QR88|TIPIN_RAT TIMELESS-interacting protein OS=Rattus norvegicus GN=Tipin PE=2 SV=1 66 174 1.0E-07
sp|Q6DBR4|TIPIN_DANRE TIMELESS-interacting protein OS=Danio rerio GN=tipin PE=2 SV=1 53 134 1.0E-07
sp|Q75DC6|CSM3_ASHGO Chromosome segregation in meiosis protein 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSM3 PE=3 SV=1 55 146 3.0E-07
sp|Q9BVW5|TIPIN_HUMAN TIMELESS-interacting protein OS=Homo sapiens GN=TIPIN PE=1 SV=2 66 134 3.0E-07
sp|Q8INX3|TIPIN_DROME Protein TIPIN homolog OS=Drosophila melanogaster GN=CG10336 PE=2 SV=2 54 136 4.0E-07
sp|Q0IHI4|TIPIN_XENLA TIMELESS-interacting protein OS=Xenopus laevis GN=tipin PE=1 SV=1 57 134 7.0E-07
sp|Q04659|CSM3_YEAST Chromosome segregation in meiosis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSM3 PE=1 SV=1 55 131 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006974 cellular response to DNA damage stimulus Yes
GO:0005634 nucleus Yes
GO:0048478 replication fork protection Yes
GO:0045934 negative regulation of nucleobase-containing compound metabolic process No
GO:0033554 cellular response to stress No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0043226 organelle No
GO:0090304 nucleic acid metabolic process No
GO:0043229 intracellular organelle No
GO:0031323 regulation of cellular metabolic process No
GO:2000104 negative regulation of DNA-templated DNA replication No
GO:0051716 cellular response to stimulus No
GO:0019222 regulation of metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0051053 negative regulation of DNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0050896 response to stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0006275 regulation of DNA replication No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0009892 negative regulation of metabolic process No
GO:0050789 regulation of biological process No
GO:0090329 regulation of DNA-templated DNA replication No
GO:0006807 nitrogen compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0006950 response to stress No
GO:0045005 DNA-templated DNA replication maintenance of fidelity No
GO:0008156 negative regulation of DNA replication No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0051172 negative regulation of nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:1901360 organic cyclic compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0048519 negative regulation of biological process No
GO:0051052 regulation of DNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0010605 negative regulation of macromolecule metabolic process No
GO:0031324 negative regulation of cellular metabolic process No
GO:0005575 cellular_component No
GO:0048523 negative regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3004
MSSSNPSRARVAGLDDYDVDDSDPFRSPSPQPAASPTSQKRKAGVSTLGLDEEVSVKKRARAPAFKLDENLLLSP
AGIPRMRERARKMRLRGRGYEFEDADRMLNMFQFWLDDLYPKARFKDALAMVEKAGHKKLLLQARMEWINEGKPG
ARKKDDEDDEVDNDDQDDNKNGNDNMDNHDDVNQRSTDQDPPQPAPNRPKTPERNDVPNPDDLDDIYDATPRAPT
RTINALSQSVDVAVQGEGQANGHQQPANNAEPDEEDLDALIAEAEGLDRKGHDSVDEDAMAEAAALNM*
Coding >Ophun1|3004
ATGTCCAGCTCCAATCCCTCACGCGCTCGCGTCGCCGGTCTTGACGACTATGATGTCGACGACTCCGATCCCTTC
CGCTCTCCCTCTCCCCAACCAGCCGCCTCGCCCACAAGCCAGAAGCGCAAAGCCGGCGTCAGCACCCTCGGCCTC
GACGAGGAAGTCTCTGTGAAGAAGCGTGCGCGAGCTCCCGCCTTTAAGCTTGATGAGAATCTCCTTCTCAGCCCG
GCTGGCATCCCGCGCATGCGCGAACGGGCCCGCAAGATGCGCCTCCGGGGTAGGGGATACGAGTTTGAGGATGCA
GACCGGATGCTCAACATGTTTCAGTTCTGGCTGGATGATTTGTATCCCAAGGCTAGGTTTAAGGATGCGTTGGCT
ATGGTTGAGAAGGCGGGACATAAGAAGCTTTTGCTTCAGGCGAGGATGGAATGGATCAACGAAGGGAAACCGGGG
GCGCGGAAGAAGGACGACGAGGATGACGAGGTGGATAACGATGACCAAGATGACAACAAGAACGGTAACGACAAC
ATGGACAACCACGATGATGTCAACCAACGCTCAACAGACCAAGATCCGCCCCAGCCCGCCCCCAACCGTCCCAAG
ACGCCGGAGCGCAACGACGTCCCCAACCCCGACGACCTCGATGACATCTACGACGCAACCCCACGCGCACCCACT
CGCACCATCAACGCCCTCTCCCAGTCCGTCGACGTCGCCGTTCAGGGCGAAGGGCAGGCCAACGGTCACCAACAA
CCCGCAAATAACGCCGAGCCGGACGAAGAGGATCTGGATGCCCTGATCGCCGAAGCGGAGGGGCTGGACCGGAAA
GGTCATGACTCTGTGGATGAGGACGCCATGGCTGAGGCGGCGGCGTTGAATATGTGA
Transcript >Ophun1|3004
ATGTCCAGCTCCAATCCCTCACGCGCTCGCGTCGCCGGTCTTGACGACTATGATGTCGACGACTCCGATCCCTTC
CGCTCTCCCTCTCCCCAACCAGCCGCCTCGCCCACAAGCCAGAAGCGCAAAGCCGGCGTCAGCACCCTCGGCCTC
GACGAGGAAGTCTCTGTGAAGAAGCGTGCGCGAGCTCCCGCCTTTAAGCTTGATGAGAATCTCCTTCTCAGCCCG
GCTGGCATCCCGCGCATGCGCGAACGGGCCCGCAAGATGCGCCTCCGGGGTAGGGGATACGAGTTTGAGGATGCA
GACCGGATGCTCAACATGTTTCAGTTCTGGCTGGATGATTTGTATCCCAAGGCTAGGTTTAAGGATGCGTTGGCT
ATGGTTGAGAAGGCGGGACATAAGAAGCTTTTGCTTCAGGCGAGGATGGAATGGATCAACGAAGGGAAACCGGGG
GCGCGGAAGAAGGACGACGAGGATGACGAGGTGGATAACGATGACCAAGATGACAACAAGAACGGTAACGACAAC
ATGGACAACCACGATGATGTCAACCAACGCTCAACAGACCAAGATCCGCCCCAGCCCGCCCCCAACCGTCCCAAG
ACGCCGGAGCGCAACGACGTCCCCAACCCCGACGACCTCGATGACATCTACGACGCAACCCCACGCGCACCCACT
CGCACCATCAACGCCCTCTCCCAGTCCGTCGACGTCGCCGTTCAGGGCGAAGGGCAGGCCAACGGTCACCAACAA
CCCGCAAATAACGCCGAGCCGGACGAAGAGGATCTGGATGCCCTGATCGCCGAAGCGGAGGGGCTGGACCGGAAA
GGTCATGACTCTGTGGATGAGGACGCCATGGCTGAGGCGGCGGCGTTGAATATGTGA
Gene >Ophun1|3004
ATGTCCAGCTCCAATCCCTCACGCGCTCGCGTCGCCGGTCTTGACGACTATGATGTCGACGACTCCGATCCCTTC
CGCTCTCCCTCTCCCCAACCAGCCGCCTCGCCCACAAGCCAGAAGCGCAAAGCCGGCGTCAGCACCCTCGGCCTC
GACGAGGAAGTCTCTGTGAAGAAGCGTGCGCGAGCTCCCGCCTTTAAGCTTGATGAGAATCTCCTTCTCAGCCCG
GCTGGCATCCCGCGCATGCGCGAACGGGCCCGCAAGATGCGCCTCCGGGGTAGGGGATACGAGTTTGAGGATGCA
GACCGGATGCTCAACATGTTTCAGTTCTGGCTGGATGATTTGTATCCCAAGGCTAGGTTTAAGGATGCGTTGGCT
ATGGTTGAGAAGGCGGGACATAAGAAGCTTTTGCTTCAGGCGAGGATGGAATGGATCAACGAAGGGAAACCGGGG
GCGCGGAAGAAGGACGACGAGGATGACGAGGTGGATAACGATGACCAAGATGACAACAAGAACGGTAACGACAAC
ATGGACAACCACGATGATGTCAACCAACGCTCAACAGACCAAGATCCGCCCCAGCCCGCCCCCAACCGTCCCAAG
ACGCCGGAGCGCAACGACGTCCCCAACCCCGACGACCTCGATGACATCTACGACGCAACCCCACGCGCACCCACT
CGCACCATCAACGCCCTCTCCCAGTCCGTCGACGTCGCCGTTCAGGGCGAAGGGCAGGCCAACGGTCACCAACAA
CCCGCAAATAACGCCGAGCCGGACGAAGAGGATCTGGATGCCCTGATCGCCGAAGCGGAGGGGCTGGACCGGAAA
GGTCATGACTCTGTGGATGAGGACGCCATGGCTGAGGCGGCGGCGTTGAATATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail