Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3003
Gene name
LocationContig_267:11437..13934
Strand-
Gene length (bp)2497
Transcript length (bp)1788
Coding sequence length (bp)1788
Protein length (aa) 596

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10785 NADH-u_ox-rdase NADH-ubiquinone oxidoreductase complex I, 21 kDa subunit 9.6E-30 22 107
PF12853 NADH_u_ox_C C-terminal of NADH-ubiquinone oxidoreductase 21 kDa subunit 7.0E-24 116 191

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02854|NUXM_NEUCR NADH-ubiquinone oxidoreductase 20.9 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo20.9 PE=1 SV=1 17 194 8.0E-84

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 45 62 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3003
MAETTIKRPPQTFVGASKVVQTDYPLIDNDPHFKRVVRYARPSDYVHGVVAAAFAPAAMLVMERFAPSHVRMGGF
ARVMRLAGFIGIAGGFLCFYQRSCLRFYGATENAREMQMDMREMVDRVKAGLPLYGESQLSPHMQGVAARQSRYS
ALFFSVLPWFNFVNHDQHGVDTAKYYQQAERELEMERTASDQQTVSPSMESFDHQQQQPSSMEPTASSSQPQPLA
MDLPVIDLDVFLHQPRDARAECVKAANALIAYGALVLRDSRVADHDNAAFLDLMEDYFAQPEDELRRDERPELGY
QIGVTLERTEKPKCAVDEPCLDVIRRLHPSQRPLDVSRHEPDPKCRFFWRMADPPPYQTLFPGLNAPNVVPRASC
LAERWEPVMDRWGAAMKTAVSTLSEMLAVGLGLPPDLFREAGRYGPHLLAPTASDLEKYGTKDTILAGFHTDLNF
LTIHGRSRYPGLNVWARNTGNRIPVKMPPGNYLLVQAGKQLEHMTGGLIKAGYHEVVVNDETIEAMDRRRREFPD
RPQIRISSTLFWHLNSDLDLEPVPGLAERAKEVRAEQARMGRDEGEPVVYPAIKVGHQVEGELKHIALMA*
Coding >Ophun1|3003
ATGGCAGAGACGACGATCAAGCGGCCTCCGCAGACGTTTGTGGGCGCGAGCAAAGTTGTCCAGACAGACTATCCG
CTCATCGACAACGACCCCCACTTCAAGAGAGTCGTCCGTTATGCTCGTCCGTCAGACTACGTCCATGGCGTCGTG
GCGGCTGCGTTCGCGCCGGCGGCCATGCTGGTAATGGAGAGGTTCGCGCCGTCGCATGTCAGGATGGGGGGGTTC
GCCAGGGTGATGCGGCTGGCTGGCTTCATCGGGATCGCCGGCGGATTTCTCTGCTTCTATCAGCGGTCGTGCCTG
CGCTTCTACGGTGCGACGGAGAATGCGCGCGAGATGCAAATGGACATGCGCGAAATGGTGGATAGGGTCAAGGCC
GGCTTGCCGCTATATGGAGAGAGCCAGCTGTCGCCGCACATGCAAGGCGTGGCGGCGCGCCAGAGCCGCTACTCG
GCCCTCTTCTTCAGCGTGCTCCCGTGGTTCAACTTTGTCAACCACGACCAGCACGGCGTCGACACGGCCAAGTAT
TACCAGCAGGCGGAGCGCGAGTTGGAGATGGAGCGGACGGCCAGCGATCAGCAGACTGTCTCACCGAGCATGGAG
TCTTTCGACCATCAGCAGCAGCAACCGTCGTCGATGGAGCCGACAGCCTCGTCTTCGCAACCTCAGCCGCTAGCC
ATGGATCTTCCCGTCATTGACCTCGACGTCTTCCTTCATCAGCCGCGCGATGCCCGAGCCGAGTGCGTCAAGGCG
GCCAACGCGCTCATCGCATACGGAGCGCTGGTCCTGCGTGACTCGCGCGTGGCCGACCATGACAACGCCGCCTTC
CTCGACCTGATGGAGGATTACTTTGCGCAGCCCGAGGACGAGCTGCGACGCGATGAGCGGCCCGAACTGGGCTAT
CAGATTGGCGTCACGCTGGAGCGGACCGAGAAGCCCAAGTGTGCGGTCGATGAGCCTTGTCTTGACGTCATTCGC
AGGCTTCATCCGTCGCAGCGGCCGCTGGATGTGTCGCGACATGAGCCGGATCCCAAGTGTCGCTTCTTCTGGCGC
ATGGCTGATCCGCCGCCGTATCAGACGCTGTTTCCGGGGCTTAACGCGCCGAATGTTGTGCCGCGGGCTTCGTGC
TTGGCTGAGCGATGGGAGCCCGTCATGGATCGTTGGGGGGCGGCTATGAAGACGGCCGTATCTACCCTCTCCGAG
ATGCTGGCCGTCGGCCTCGGCCTCCCTCCTGACCTCTTCCGAGAAGCCGGACGATACGGCCCCCATCTCCTCGCA
CCGACGGCGTCAGACCTGGAAAAGTACGGCACCAAGGACACGATCCTAGCCGGCTTCCATACCGATCTCAACTTC
CTCACCATCCACGGCCGCTCCCGCTATCCCGGGCTCAACGTCTGGGCGCGCAACACGGGGAACCGGATTCCCGTC
AAGATGCCACCGGGCAACTACCTCCTCGTGCAGGCGGGCAAACAACTCGAGCATATGACGGGCGGCCTCATCAAG
GCAGGTTACCACGAGGTGGTGGTCAACGACGAGACGATAGAGGCCATGGACCGTCGGAGACGCGAGTTTCCGGAC
CGGCCGCAAATCCGCATCTCCAGTACCTTGTTCTGGCATCTCAACTCCGACTTGGATCTCGAGCCTGTGCCGGGC
TTGGCGGAGCGGGCCAAGGAGGTTCGGGCTGAGCAGGCGAGGATGGGTCGTGATGAGGGGGAACCGGTTGTGTAT
CCGGCTATCAAGGTCGGACATCAGGTCGAAGGTGAGCTCAAGCACATTGCCTTGATGGCGTGA
Transcript >Ophun1|3003
ATGGCAGAGACGACGATCAAGCGGCCTCCGCAGACGTTTGTGGGCGCGAGCAAAGTTGTCCAGACAGACTATCCG
CTCATCGACAACGACCCCCACTTCAAGAGAGTCGTCCGTTATGCTCGTCCGTCAGACTACGTCCATGGCGTCGTG
GCGGCTGCGTTCGCGCCGGCGGCCATGCTGGTAATGGAGAGGTTCGCGCCGTCGCATGTCAGGATGGGGGGGTTC
GCCAGGGTGATGCGGCTGGCTGGCTTCATCGGGATCGCCGGCGGATTTCTCTGCTTCTATCAGCGGTCGTGCCTG
CGCTTCTACGGTGCGACGGAGAATGCGCGCGAGATGCAAATGGACATGCGCGAAATGGTGGATAGGGTCAAGGCC
GGCTTGCCGCTATATGGAGAGAGCCAGCTGTCGCCGCACATGCAAGGCGTGGCGGCGCGCCAGAGCCGCTACTCG
GCCCTCTTCTTCAGCGTGCTCCCGTGGTTCAACTTTGTCAACCACGACCAGCACGGCGTCGACACGGCCAAGTAT
TACCAGCAGGCGGAGCGCGAGTTGGAGATGGAGCGGACGGCCAGCGATCAGCAGACTGTCTCACCGAGCATGGAG
TCTTTCGACCATCAGCAGCAGCAACCGTCGTCGATGGAGCCGACAGCCTCGTCTTCGCAACCTCAGCCGCTAGCC
ATGGATCTTCCCGTCATTGACCTCGACGTCTTCCTTCATCAGCCGCGCGATGCCCGAGCCGAGTGCGTCAAGGCG
GCCAACGCGCTCATCGCATACGGAGCGCTGGTCCTGCGTGACTCGCGCGTGGCCGACCATGACAACGCCGCCTTC
CTCGACCTGATGGAGGATTACTTTGCGCAGCCCGAGGACGAGCTGCGACGCGATGAGCGGCCCGAACTGGGCTAT
CAGATTGGCGTCACGCTGGAGCGGACCGAGAAGCCCAAGTGTGCGGTCGATGAGCCTTGTCTTGACGTCATTCGC
AGGCTTCATCCGTCGCAGCGGCCGCTGGATGTGTCGCGACATGAGCCGGATCCCAAGTGTCGCTTCTTCTGGCGC
ATGGCTGATCCGCCGCCGTATCAGACGCTGTTTCCGGGGCTTAACGCGCCGAATGTTGTGCCGCGGGCTTCGTGC
TTGGCTGAGCGATGGGAGCCCGTCATGGATCGTTGGGGGGCGGCTATGAAGACGGCCGTATCTACCCTCTCCGAG
ATGCTGGCCGTCGGCCTCGGCCTCCCTCCTGACCTCTTCCGAGAAGCCGGACGATACGGCCCCCATCTCCTCGCA
CCGACGGCGTCAGACCTGGAAAAGTACGGCACCAAGGACACGATCCTAGCCGGCTTCCATACCGATCTCAACTTC
CTCACCATCCACGGCCGCTCCCGCTATCCCGGGCTCAACGTCTGGGCGCGCAACACGGGGAACCGGATTCCCGTC
AAGATGCCACCGGGCAACTACCTCCTCGTGCAGGCGGGCAAACAACTCGAGCATATGACGGGCGGCCTCATCAAG
GCAGGTTACCACGAGGTGGTGGTCAACGACGAGACGATAGAGGCCATGGACCGTCGGAGACGCGAGTTTCCGGAC
CGGCCGCAAATCCGCATCTCCAGTACCTTGTTCTGGCATCTCAACTCCGACTTGGATCTCGAGCCTGTGCCGGGC
TTGGCGGAGCGGGCCAAGGAGGTTCGGGCTGAGCAGGCGAGGATGGGTCGTGATGAGGGGGAACCGGTTGTGTAT
CCGGCTATCAAGGTCGGACATCAGGTCGAAGGTGAGCTCAAGCACATTGCCTTGATGGCGTGA
Gene >Ophun1|3003
ATGGCAGAGACGACGATCAAGCGGCCTCCGCAGACGTTTGTGGGCGCGAGCAAAGTTGTCCAGACAGACTATCCG
GTATGAAGATGTCTCGAAGAGAGGGTGGCGGGCGCAGCTAATTCGTCAGGGCGCAGCTCATCGACAACGACCCGT
ACGTGTTCCCTTGAACAAGCGAGATGGGTGCCCCCGTCGTTCTCTGATCTTCCAGCAGCCACTTCAAGAGAGTCG
TCCGTTATGCTCGTCCGTCAGACTACGTCCATGGCGTCGTGGCGGCTGCGTTCGCGCCGGCGGCCATGCTGGTAA
TGGAGAGGTTCGCGCCGTCGCATGTCAGGATGGGGGGGTTCGCCAGGGTGATGCGGCTGGCTGGCTTCATCGGGA
TCGCCGGCGGATTTCTCTGCTTCTATCAGCGGTCGTGCCGTGAGTGCCAACCCTCCTATTGCCCCCCATCAGGCG
TGCTGACAGCCAACTCGACCAAGTGCGCTTCTACGGTGCGACGGAGAATGCGCGCGAGATGCAAATGGACATGCG
CGAAATGGTGGATAGGGTCAAGGCCGGCTTGCCGCTATATGGAGAGAGCCAGCTGTCGCCGCACATGCAAGGCGT
GGCGGCGCGCCAGAGCCGCTACTCGGCCCTCTTCTTCAGCGTGCTCCCGTGGTTCAACTTTGTCAACCACGACCA
GCACGGCGTCGACACGGCCAAGTATTACCAGCAGGCGGAGCGCGAGTTGGAGATGGAGCGGACGGCCAGCGGTTC
GTGAGGATCATTTCAGAGGGTCGTGACAGTACTTCATACAACGCGGGCTACACGGGGAAAAGAAGGTCGCATTCA
TGTCCCTTTTGGCCATAGGTAGGCCAAGAGAATGCATCATTGACCGAGGCCCTCGCCACTCGTGCTTCAAGGCGC
GCGGCTGACCGGGGGCCGCATGACGGAGCGGAGGCGCACGTGCCAAGGCCGTCGTCTCCCGAGTTCCGCCGGCGT
TTGTTTTGAAACTAAGCAACGGATGACTCGCCAGCAAGACAGGAGAAGACGAAGCCAGCTTGACAAGACAAGGCA
CGAGACTGCGCCCATCGTGTCTCTCAAGCCTCAGCAGATCAGCAGACTGTCTCACCGAGCATGGAGTCTTTCGAC
CATCAGCAGCAGCAACCGTCGTCGATGGAGCCGACAGCCTCGTCTTCGCAACCTCAGCCGCTAGCCATGGATCTT
CCCGTCATTGACCTCGACGTCTTCCTTCATCAGCCGCGCGATGCCCGAGCCGAGTGCGTCAAGGCGGCCAACGCG
CTCATCGCATACGGAGCGCTGGTCCTGCGTGACTCGCGCGTGGCCGACCATGACAACGCCGCCTTCCTCGACCTG
ATGGAGGATTACTTTGCGCAGCCCGAGGACGAGCTGCGACGCGATGAGCGGCCCGAACTGGGCTATCAGATTGGC
GTCACGCTGGAGCGGACCGAGAAGCCCAAGTGTGCGGTCGATGAGCCTTGTCTTGACGTCATTCGCAGGCTTCAT
CCGTCGCAGCGGCCGCTGGATGTGTCGCGACATGAGCCGGATCCCAAGTGTCGCTTCTTCTGGCGCATGGCTGAT
CCGCCGCCGTATCAGACGCTGTTTCCGGGGCTTAACGCGCCGAATGTTGTGCCGCGGGCTTCGTGCTTGGCTGAG
CGATGGGAGCCCGTCATGGATCGTTGGGGGGCGGCTATGAAGACGGCGTACGTCTGATGGGTTCTATCATTGTGG
TCTCGTCCTTGGCTGCTGATCGCACATGTTGTTTACAAGCGTATCTACCCTCTCCGAGATGCTGGCCGTCGGCCT
CGGCCTCCCTCCTGACCTCTTCCGAGAAGCCGGACGATACGGGTTGGGGCTCCTCTGATGCTTGCTGTGAGAGAC
GAGCAACAGCTGACGAGCCGCAGCCCCCATCTCCTCGCACCGACGGCGTCAGACCTGGAAAAGTACGGCACCAAG
GACACGATCCTAGCCGGCTTCCATACCGATCTCAACTTCCTCACCATCCACGGCCGCTCCCGCTATCCCGGGCTC
AACGTCTGGGCGCGCAACACGGGGAACCGGATTCCCGTCAAGATGCCACCGGGCAACTACCTCCTCGTGCAGGCG
GGCAAACAACTCGAGCATATGACGGGCGGCCTCATCAAGGCAGGTTACCACGAGGTGGTGGTCAACGACGAGACG
ATAGAGGCCATGGACCGTCGGAGACGCGAGTTTCCGGACCGGCCGCAAATCCGCATCTCCAGTACCTTGTTCTGG
CATCTCAACTCCGACTTGGATCTCGAGCCTGTGCCGGGCTTGGCGGAGCGGGCCAAGGAGGTTCGGGCTGAGCAG
GCGAGGATGGGTCGTGATGAGGGGGAACCGGTTGTGTATCCGGCTATCAAGGTCGGACATCAGGTCGAAGGGTGA
GTGACGGTTGCTTCCCATCAACGTCTTTTGAGGCGTATGGCTGACAAGGTCGATTCATCCTCGCAGTGAGCTCAA
GCACATTGCCTTGATGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail