Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3002
Gene name
LocationContig_267:9337..11318
Strand+
Gene length (bp)1981
Transcript length (bp)1746
Coding sequence length (bp)1746
Protein length (aa) 582

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00860 Xan_ur_permease Permease family 5.9E-12 95 198
PF00860 Xan_ur_permease Permease family 8.7E-17 248 474
PF00916 Sulfate_transp Sulfate permease family 1.0E-05 376 445

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94300|YOOH_SCHPO Putative xanthine/uracil permease C887.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.17 PE=3 SV=1 3 580 0.0E+00
sp|Q9SRK7|AZG1_ARATH Adenine/guanine permease AZG1 OS=Arabidopsis thaliana GN=AZG1 PE=2 SV=1 5 491 4.0E-141
sp|Q84MA8|AZG2_ARATH Adenine/guanine permease AZG2 OS=Arabidopsis thaliana GN=AZG2 PE=2 SV=1 7 488 3.0E-122
sp|Q57772|Y326_METJA Putative permease MJ0326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0326 PE=3 SV=1 18 497 3.0E-56
sp|O34978|PBUO_BACSU Guanine/hypoxanthine permease PbuO OS=Bacillus subtilis (strain 168) GN=pbuO PE=1 SV=1 29 483 5.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94300|YOOH_SCHPO Putative xanthine/uracil permease C887.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.17 PE=3 SV=1 3 580 0.0E+00
sp|Q9SRK7|AZG1_ARATH Adenine/guanine permease AZG1 OS=Arabidopsis thaliana GN=AZG1 PE=2 SV=1 5 491 4.0E-141
sp|Q84MA8|AZG2_ARATH Adenine/guanine permease AZG2 OS=Arabidopsis thaliana GN=AZG2 PE=2 SV=1 7 488 3.0E-122
sp|Q57772|Y326_METJA Putative permease MJ0326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0326 PE=3 SV=1 18 497 3.0E-56
sp|O34978|PBUO_BACSU Guanine/hypoxanthine permease PbuO OS=Bacillus subtilis (strain 168) GN=pbuO PE=1 SV=1 29 483 5.0E-55
sp|O34987|PBUG_BACSU Guanine/hypoxanthine permease PbuG OS=Bacillus subtilis (strain 168) GN=pbuG PE=1 SV=1 39 500 5.0E-55
sp|P31440|ADEQ_ECOLI Adenine permease AdeQ OS=Escherichia coli (strain K12) GN=adeQ PE=1 SV=3 1 476 7.0E-53
sp|P31466|ADEP_ECOLI Adenine permease AdeP OS=Escherichia coli (strain K12) GN=adeP PE=1 SV=2 16 488 1.0E-50
sp|P0AF52|GHXP_ECOLI Guanine/hypoxanthine permease GhxP OS=Escherichia coli (strain K12) GN=ghxP PE=1 SV=1 16 477 4.0E-35
sp|P0AF53|GHXP_ECO57 Guanine/hypoxanthine permease GhxP OS=Escherichia coli O157:H7 GN=ghxP PE=3 SV=1 16 477 4.0E-35
sp|P44530|Y125_HAEIN Putative permease HI_0125 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0125 PE=3 SV=1 27 486 4.0E-32
sp|Q46817|GHXQ_ECOLI Guanine/hypoxanthine permease GhxQ OS=Escherichia coli (strain K12) GN=ghxQ PE=1 SV=2 16 477 1.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0015116 sulfate transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0008272 sulfate transport Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0006820 anion transport No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0051179 localization No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0072348 sulfur compound transport No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0015698 inorganic anion transport No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 102 124 22
2 144 166 22
3 186 208 22
4 240 257 17
5 324 346 22
6 366 388 22
7 401 423 22
8 427 446 19
9 459 493 34

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3002
MGWANTINERAATSPLGHWFRLQGSGHPLSRKDSLFLTEIRAGLATFFAMAYIMAVNSSIVADSGGPCVCPRTAA
DPDCDADVGYMLCVQGVKRDAVTATAAVSALASVCMGLFANLPIGLAPGMGLNAYFAYTVVGYHGKGPVPYQVAL
TAIFVEGFIFLFLALVGMRQWLARAIPHSIKVATGVGIGLFLALIGFTYNEGIGLVLGAVATPTQLAGCSPSLLR
DGACPGADKMRNPTLWLGIFAGGILTVLLAMYRVRGAVIVGIILVSVVSWPRDTPVTAFPRTPLGDNAFDFFRRV
VSFHPIRRILNVQRWDVAEYGPQFGLALVTFLYVDILDCTGTLYGMARFAGLLDPVTHDFEGSSVAYVVDALSIS
VGAVLGIPPVTAFVESGAGISEGGKTGLTAVVTGLCFLVAVFFAPIFASIPPWATGCVLILVGSMMASSVADINW
KYMGDAVPAFLAIVLMPFTYSIANGLIGSICCYAALNLVVWLLKLLSRGRIVPPNYADKEPWTWRIPGGFFPPWI
VRLSKGDCRFWRRDSPAPTPDSMCREPKLSSEPGADRSSSAETNSVRGSEWRSGDR*
Coding >Ophun1|3002
ATGGGCTGGGCAAACACCATCAACGAAAGGGCAGCAACCAGCCCCCTCGGCCACTGGTTCCGCCTCCAAGGAAGC
GGCCATCCCCTCTCGCGCAAAGACTCGCTCTTCCTCACCGAGATCCGCGCCGGACTGGCCACCTTCTTCGCCATG
GCCTACATCATGGCCGTCAACTCGTCCATCGTCGCCGACTCGGGCGGGCCCTGCGTCTGTCCTCGCACGGCTGCC
GATCCCGATTGCGATGCCGATGTTGGCTATATGCTCTGCGTCCAGGGCGTTAAGCGCGATGCTGTTACTGCTACG
GCTGCGGTGTCGGCGCTGGCGTCGGTCTGTATGGGGTTGTTTGCCAATCTTCCCATTGGCCTCGCTCCCGGCATG
GGCCTCAACGCCTACTTCGCCTACACCGTCGTCGGCTACCACGGCAAAGGCCCCGTCCCCTATCAAGTAGCCCTA
ACCGCCATCTTCGTCGAAGGCTTCATCTTCCTCTTCCTCGCCCTCGTGGGAATGCGCCAATGGCTCGCCCGCGCC
ATCCCCCACTCCATCAAAGTCGCCACGGGCGTTGGAATAGGCCTCTTCCTCGCCCTCATCGGCTTCACCTACAAC
GAGGGCATCGGCCTTGTCCTCGGCGCCGTTGCTACTCCCACGCAGTTGGCCGGCTGCTCGCCCTCGCTTCTTCGT
GACGGCGCGTGTCCCGGAGCGGACAAGATGCGGAATCCGACGCTGTGGCTCGGCATCTTTGCTGGAGGCATCTTG
ACGGTTCTGCTGGCCATGTATCGCGTTCGAGGAGCCGTCATCGTGGGCATCATCCTCGTCAGCGTCGTCTCTTGG
CCGAGAGATACCCCCGTAACCGCCTTTCCCAGGACTCCCCTTGGAGACAACGCCTTCGACTTCTTCCGTCGCGTC
GTCAGCTTCCATCCCATCCGACGAATCCTCAATGTCCAGCGCTGGGACGTAGCAGAGTACGGTCCTCAATTCGGT
CTCGCTCTCGTCACCTTTCTCTATGTCGATATCCTCGATTGCACCGGCACTTTATACGGCATGGCTCGCTTCGCC
GGTCTCCTCGATCCCGTCACGCACGACTTTGAGGGCTCATCCGTTGCCTACGTCGTCGACGCCCTCAGCATCTCC
GTCGGCGCCGTCCTCGGCATCCCTCCGGTCACCGCCTTCGTCGAGTCCGGAGCCGGCATCTCAGAGGGCGGCAAG
ACGGGGCTGACGGCCGTCGTCACGGGCCTGTGCTTCCTCGTCGCCGTCTTCTTCGCTCCCATCTTCGCCTCCATC
CCTCCCTGGGCCACCGGCTGCGTCCTCATCCTCGTCGGCTCCATGATGGCCTCCTCCGTTGCTGATATCAACTGG
AAGTACATGGGCGACGCTGTTCCCGCCTTTCTCGCCATCGTCCTCATGCCCTTTACCTACTCCATCGCCAACGGT
CTCATCGGAAGCATCTGCTGCTACGCCGCCCTCAACCTCGTCGTCTGGCTCCTCAAGCTGCTCTCCCGCGGCCGG
ATCGTACCCCCTAATTACGCTGACAAGGAGCCCTGGACCTGGCGCATCCCCGGTGGCTTCTTCCCTCCCTGGATC
GTCCGCCTGTCCAAGGGAGACTGCCGCTTCTGGCGTCGAGACTCGCCCGCGCCCACCCCTGATTCTATGTGCCGC
GAACCCAAGCTCAGCTCCGAGCCGGGCGCCGACCGGAGCTCATCTGCCGAGACCAACTCAGTCAGGGGCTCTGAA
TGGAGATCCGGAGACCGCTAG
Transcript >Ophun1|3002
ATGGGCTGGGCAAACACCATCAACGAAAGGGCAGCAACCAGCCCCCTCGGCCACTGGTTCCGCCTCCAAGGAAGC
GGCCATCCCCTCTCGCGCAAAGACTCGCTCTTCCTCACCGAGATCCGCGCCGGACTGGCCACCTTCTTCGCCATG
GCCTACATCATGGCCGTCAACTCGTCCATCGTCGCCGACTCGGGCGGGCCCTGCGTCTGTCCTCGCACGGCTGCC
GATCCCGATTGCGATGCCGATGTTGGCTATATGCTCTGCGTCCAGGGCGTTAAGCGCGATGCTGTTACTGCTACG
GCTGCGGTGTCGGCGCTGGCGTCGGTCTGTATGGGGTTGTTTGCCAATCTTCCCATTGGCCTCGCTCCCGGCATG
GGCCTCAACGCCTACTTCGCCTACACCGTCGTCGGCTACCACGGCAAAGGCCCCGTCCCCTATCAAGTAGCCCTA
ACCGCCATCTTCGTCGAAGGCTTCATCTTCCTCTTCCTCGCCCTCGTGGGAATGCGCCAATGGCTCGCCCGCGCC
ATCCCCCACTCCATCAAAGTCGCCACGGGCGTTGGAATAGGCCTCTTCCTCGCCCTCATCGGCTTCACCTACAAC
GAGGGCATCGGCCTTGTCCTCGGCGCCGTTGCTACTCCCACGCAGTTGGCCGGCTGCTCGCCCTCGCTTCTTCGT
GACGGCGCGTGTCCCGGAGCGGACAAGATGCGGAATCCGACGCTGTGGCTCGGCATCTTTGCTGGAGGCATCTTG
ACGGTTCTGCTGGCCATGTATCGCGTTCGAGGAGCCGTCATCGTGGGCATCATCCTCGTCAGCGTCGTCTCTTGG
CCGAGAGATACCCCCGTAACCGCCTTTCCCAGGACTCCCCTTGGAGACAACGCCTTCGACTTCTTCCGTCGCGTC
GTCAGCTTCCATCCCATCCGACGAATCCTCAATGTCCAGCGCTGGGACGTAGCAGAGTACGGTCCTCAATTCGGT
CTCGCTCTCGTCACCTTTCTCTATGTCGATATCCTCGATTGCACCGGCACTTTATACGGCATGGCTCGCTTCGCC
GGTCTCCTCGATCCCGTCACGCACGACTTTGAGGGCTCATCCGTTGCCTACGTCGTCGACGCCCTCAGCATCTCC
GTCGGCGCCGTCCTCGGCATCCCTCCGGTCACCGCCTTCGTCGAGTCCGGAGCCGGCATCTCAGAGGGCGGCAAG
ACGGGGCTGACGGCCGTCGTCACGGGCCTGTGCTTCCTCGTCGCCGTCTTCTTCGCTCCCATCTTCGCCTCCATC
CCTCCCTGGGCCACCGGCTGCGTCCTCATCCTCGTCGGCTCCATGATGGCCTCCTCCGTTGCTGATATCAACTGG
AAGTACATGGGCGACGCTGTTCCCGCCTTTCTCGCCATCGTCCTCATGCCCTTTACCTACTCCATCGCCAACGGT
CTCATCGGAAGCATCTGCTGCTACGCCGCCCTCAACCTCGTCGTCTGGCTCCTCAAGCTGCTCTCCCGCGGCCGG
ATCGTACCCCCTAATTACGCTGACAAGGAGCCCTGGACCTGGCGCATCCCCGGTGGCTTCTTCCCTCCCTGGATC
GTCCGCCTGTCCAAGGGAGACTGCCGCTTCTGGCGTCGAGACTCGCCCGCGCCCACCCCTGATTCTATGTGCCGC
GAACCCAAGCTCAGCTCCGAGCCGGGCGCCGACCGGAGCTCATCTGCCGAGACCAACTCAGTCAGGGGCTCTGAA
TGGAGATCCGGAGACCGCTAG
Gene >Ophun1|3002
ATGGGCTGGGCAAACACCATCAACGAAAGGGCAGCAACCAGCCCCCTCGGCCACTGGTTCCGCCTCCAAGGAAGC
GGCCATGTAAGTCCCCCATCCCTACCTACCCAAGATCCTCTCCTCATCACTCACGCCCACAGCCCCTCTCGCGCA
AAGACTCGCTCTTCCTCACCGAGATCCGCGCCGGACTGGCCACCTTCTTCGCCATGGCCTACATCATGGCCGTCA
ACTCGTCCATCGTCGCCGACTCGGGCGGGCCCTGCGTCTGTCCTCGCACGGCTGCCGATCCCGATTGCGATGCCG
ATGTTGGCTATATGCTCTGCGTCCAGGGCGTTAAGCGCGATGCTGTTACTGCTACGGCTGCGGTGTCGGCGCTGG
CGTCGGTCTGTATGGGGTTGTTTGCCAATCTGTGAGTTGCCTGTAGATATCTACTTGGGTTGATGGGGACGTCTG
GCTGATGATGATAGTCCCATTGGCCTCGCTCCCGGCATGGGTGAGTTCGAAGTCTAGGAGACAAGAGATGCAACC
TGACCCCTATATCCAGGCCTCAACGCCTACTTCGCCTACACCGTCGGTAAGCAACCCCCCCCCCCTTAGGTTACC
CCTGAGCCTCACTCACCACTGACTCTCTCTCTCCCCCCCAGTCGGCTACCACGGCAAAGGCCCCGTCCCCTATCA
AGTAGCCCTAACCGCCATCTTCGTCGAAGGCTTCATCTTCCTCTTCCTCGCCCTCGTGGGAATGCGCCAATGGCT
CGCCCGCGCCATCCCCCACTCCATCAAAGTCGCCACGGGCGTTGGAATAGGCCTCTTCCTCGCCCTCATCGGCTT
CACCTACAACGAGGGCATCGGCCTTGTCCTCGGCGCCGTTGCTACTCCCACGCAGTTGGCCGGCTGCTCGCCCTC
GCTTCTTCGTGACGGCGCGTGTCCCGGAGCGGACAAGATGCGGAATCCGACGCTGTGGCTCGGCATCTTTGCTGG
AGGCATCTTGACGGTTCTGCTGGCCATGTATCGCGTTCGAGGAGCCGTCATCGTGGGCATCATCCTCGTCAGCGT
CGTCTCTTGGCCGAGAGATACCCCCGTAACCGCCTTTCCCAGGACTCCCCTTGGAGACAACGCCTTCGACTTCTT
CCGTCGCGTCGTCAGCTTCCATCCCATCCGACGAATCCTCAATGTCCAGCGCTGGGACGTAGCAGAGTACGGTCC
TCAATTCGGTCTCGCTCTCGTCACCTTTCTCTATGTCGATATCCTCGATTGCACCGGCACTTTATACGGCATGGC
TCGCTTCGCCGGTCTCCTCGATCCCGTCACGCACGACTTTGAGGGCTCATCCGTTGCCTACGTCGTCGACGCCCT
CAGCATCTCCGTCGGCGCCGTCCTCGGCATCCCTCCGGTCACCGCCTTCGTCGAGTCCGGAGCCGGCATCTCAGA
GGGCGGCAAGACGGGGCTGACGGCCGTCGTCACGGGCCTGTGCTTCCTCGTCGCCGTCTTCTTCGCTCCCATCTT
CGCCTCCATCCCTCCCTGGGCCACCGGCTGCGTCCTCATCCTCGTCGGCTCCATGATGGCCTCCTCCGTTGCTGA
TATCAACTGGAAGTACATGGGCGACGCTGTTCCCGCCTTTCTCGCCATCGTCCTCATGCCCTTTACCTACTCCAT
CGCCAACGGTCTCATCGGAAGCATCTGCTGCTACGCCGCCCTCAACCTCGTCGTCTGGCTCCTCAAGCTGCTCTC
CCGCGGCCGGATCGTACCCCCTAATTACGCTGACAAGGAGCCCTGGACCTGGCGCATCCCCGGTGGCTTCTTCCC
TCCCTGGATCGTCCGCCTGTCCAAGGGAGACTGCCGCTTCTGGCGTCGAGACTCGCCCGCGCCCACCCCTGATTC
TATGTGCCGCGAACCCAAGCTCAGCTCCGAGCCGGGCGCCGACCGGAGCTCATCTGCCGAGACCAACTCAGTCAG
GGGCTCTGAATGGAGATCCGGAGACCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail