Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2999
Gene name
LocationContig_267:2085..3816
Strand-
Gene length (bp)1731
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.1E-87 47 504
PF07690 MFS_1 Major Facilitator Superfamily 4.2E-16 52 450

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 9 521 7.0E-145
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 9 521 5.0E-144
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 20 548 6.0E-142
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 20 541 7.0E-142
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 20 541 9.0E-142
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 9 521 7.0E-145
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 9 521 5.0E-144
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 20 548 6.0E-142
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 20 541 7.0E-142
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 20 541 9.0E-142
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 20 521 1.0E-141
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 20 521 1.0E-141
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 5 521 7.0E-138
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 58 512 1.0E-29
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 43 506 4.0E-27
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 23 508 2.0E-25
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 48 560 4.0E-25
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 58 535 5.0E-25
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 43 506 2.0E-24
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 56 535 7.0E-24
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 74 575 9.0E-24
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 41 522 1.0E-23
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 35 508 4.0E-23
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 58 507 4.0E-23
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 43 512 5.0E-23
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 48 504 9.0E-23
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 53 556 1.0E-22
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 48 504 1.0E-22
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 67 501 1.0E-21
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 147 528 2.0E-21
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 147 528 3.0E-21
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 142 523 3.0E-21
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 58 539 4.0E-21
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 58 520 9.0E-21
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 50 528 1.0E-20
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 43 502 2.0E-20
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 58 509 2.0E-20
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 103 528 2.0E-20
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 56 512 3.0E-20
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 32 512 4.0E-20
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 48 504 7.0E-20
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 48 563 7.0E-20
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 58 507 8.0E-20
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 58 507 8.0E-20
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 58 507 1.0E-19
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 104 507 1.0E-19
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 103 522 1.0E-19
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 37 508 1.0E-19
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 56 536 1.0E-19
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 37 508 2.0E-19
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 58 507 2.0E-19
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 48 508 2.0E-19
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 35 535 2.0E-19
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 121 512 2.0E-19
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 56 512 2.0E-19
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 58 522 3.0E-19
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 103 522 3.0E-19
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 48 508 3.0E-19
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 58 522 3.0E-19
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 103 522 3.0E-19
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 147 508 4.0E-19
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 48 526 4.0E-19
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 37 508 5.0E-19
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 103 522 5.0E-19
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 58 504 1.0E-18
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 58 554 1.0E-18
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 58 506 1.0E-18
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 65 539 2.0E-18
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 58 512 3.0E-18
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 52 505 4.0E-18
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 35 535 5.0E-18
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 58 512 6.0E-18
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 102 502 7.0E-18
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 40 516 2.0E-17
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 40 516 2.0E-17
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 93 507 2.0E-17
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 40 505 2.0E-17
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 56 535 4.0E-17
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 141 512 5.0E-17
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 89 507 6.0E-17
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 106 524 8.0E-17
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 144 522 1.0E-16
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 78 502 1.0E-16
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 35 506 2.0E-16
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 58 507 2.0E-16
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 78 501 4.0E-16
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 56 528 5.0E-16
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 103 522 6.0E-16
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 129 501 7.0E-16
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 92 507 1.0E-15
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 41 502 1.0E-15
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 103 522 1.0E-15
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 93 507 1.0E-15
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 103 536 2.0E-15
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 103 536 3.0E-15
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 31 549 3.0E-15
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 58 506 5.0E-15
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 44 501 5.0E-15
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 104 501 5.0E-15
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 58 506 7.0E-15
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 72 538 7.0E-15
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 141 500 7.0E-15
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 103 522 9.0E-15
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 58 500 1.0E-14
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 55 484 1.0E-14
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 142 507 2.0E-14
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 26 499 2.0E-14
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 103 522 2.0E-14
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 148 533 2.0E-14
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 56 538 2.0E-14
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 129 501 2.0E-14
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 102 507 3.0E-14
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 73 501 3.0E-14
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 117 501 4.0E-14
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 102 502 4.0E-14
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 30 510 5.0E-14
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 78 501 5.0E-14
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 104 509 5.0E-14
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 142 507 6.0E-14
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 58 532 9.0E-14
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 32 493 2.0E-13
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 97 501 2.0E-13
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 78 508 2.0E-13
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 73 493 2.0E-13
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 73 493 2.0E-13
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 115 516 2.0E-13
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 56 534 2.0E-13
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 56 537 3.0E-13
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 148 507 3.0E-13
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 142 532 4.0E-13
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 117 510 4.0E-13
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 97 501 5.0E-13
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 165 535 6.0E-13
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 115 395 8.0E-13
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 45 501 1.0E-12
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 117 508 1.0E-12
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 117 508 1.0E-12
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 79 501 2.0E-12
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 151 535 3.0E-12
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 45 501 4.0E-12
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 102 385 4.0E-12
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 102 385 4.0E-12
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 102 385 4.0E-12
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 56 538 4.0E-12
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 58 537 5.0E-12
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 151 547 7.0E-12
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 117 508 7.0E-12
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 117 508 7.0E-12
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 100 395 1.0E-11
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 42 493 1.0E-11
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 95 385 1.0E-11
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 78 335 1.0E-11
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 142 507 1.0E-11
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 117 370 2.0E-11
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 31 535 2.0E-11
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 79 501 3.0E-11
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 112 506 4.0E-11
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 117 508 4.0E-11
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 104 428 4.0E-11
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 45 501 6.0E-11
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 117 508 8.0E-11
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 151 538 1.0E-10
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 151 538 1.0E-10
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 31 549 1.0E-10
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 101 261 1.0E-10
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 117 508 1.0E-10
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 117 508 2.0E-10
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 45 501 2.0E-10
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 108 507 2.0E-10
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 47 500 2.0E-10
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 115 500 3.0E-10
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 104 503 4.0E-10
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 117 508 5.0E-10
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 104 442 7.0E-10
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 122 526 1.0E-09
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 73 501 1.0E-09
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 104 501 1.0E-09
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 58 370 1.0E-09
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 117 508 2.0E-09
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 104 504 2.0E-09
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 85 495 2.0E-09
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 73 501 2.0E-09
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 73 501 2.0E-09
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 151 548 2.0E-09
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 36 508 5.0E-09
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 58 436 5.0E-09
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 104 501 5.0E-09
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 125 507 7.0E-09
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 119 333 8.0E-09
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 104 504 8.0E-09
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 87 387 8.0E-09
sp|Q9R1U7|S22A8_RAT Solute carrier family 22 member 8 OS=Rattus norvegicus GN=Slc22a8 PE=1 SV=1 102 337 1.0E-08
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 119 257 1.0E-08
sp|Q5R9C4|S22A8_PONAB Solute carrier family 22 member 8 OS=Pongo abelii GN=SLC22A8 PE=2 SV=1 102 337 2.0E-08
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 104 325 2.0E-08
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 142 506 2.0E-08
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 73 333 3.0E-08
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 94 441 3.0E-08
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 47 494 4.0E-08
sp|Q4W8A2|S22A8_MACFA Solute carrier family 22 member 8 OS=Macaca fascicularis GN=SLC22A8 PE=2 SV=1 102 337 4.0E-08
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 38 384 5.0E-08
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 89 348 5.0E-08
sp|Q8HY24|S22A8_RABIT Solute carrier family 22 member 8 OS=Oryctolagus cuniculus GN=SLC22A8 PE=2 SV=1 102 337 5.0E-08
sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo sapiens GN=SLC22A8 PE=1 SV=1 102 337 6.0E-08
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 99 359 6.0E-08
sp|Q80UJ1|S22AK_MOUSE Solute carrier family 22 member 20 OS=Mus musculus GN=Slc22a20 PE=1 SV=1 102 455 9.0E-08
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 89 348 1.0E-07
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 141 507 1.0E-07
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 115 506 1.0E-07
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 89 295 2.0E-07
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 115 384 2.0E-07
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 225 433 3.0E-07
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 94 387 3.0E-07
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 148 503 5.0E-07
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 102 385 7.0E-07
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 93 256 9.0E-07
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 104 433 9.0E-07
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 228 450 1.0E-06
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 104 433 1.0E-06
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 142 506 1.0E-06
sp|O88909|S22A8_MOUSE Solute carrier family 22 member 8 OS=Mus musculus GN=Slc22a8 PE=1 SV=2 166 382 2.0E-06
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 104 315 2.0E-06
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 117 508 2.0E-06
sp|A6NK97|S22AK_HUMAN Solute carrier family 22 member 20 OS=Homo sapiens GN=SLC22A20 PE=2 SV=1 102 455 3.0E-06
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 85 506 4.0E-06
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 45 333 6.0E-06
sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 172 376 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 90 112 22
3 125 144 19
4 149 171 22
5 184 206 22
6 221 243 22
7 305 327 22
8 342 361 19
9 368 390 22
10 405 424 19
11 437 455 18
12 470 487 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2999
MASKDTPPDEKVVNLLTVCEAAEATEVERNMGLLKSLKVYKKACLWSIFISVCIVMEGYDTVILNSLYAYPPFVR
DFGSRSGSHDEFEIPAAWQSGLSNGALCGQILGLFFNGIVAERIGYRKTLMGALLACVGFIAVLFFAASLPQLLV
GEILIGIPWGVFQTLTTAYAAEVCPTHLRAYLTTYINLCWVMGQFIASGLLRAMVPRTDRWGYKIPFAVEWAWPL
PLVVGIWLAPESPWWLVRHGRFDEAKKTVERLTSRNSGVAFQPDQTVSMMMHTDEMEREAVAGTSYRDLFRGANL
RRTEIVCVTWMIQTLCGSTFMNYSTYFYHKAGLAVEQSFSMSLAQYGLGAVGTLTAWFLMGLAGRRTLYLSGQLI
MACLLLTIGVTGSVAARGDKAAQWAIGSMLLVYALVYNATVGPVCYSLVSELTSTRLRTKSVVLARNVYNLSGIV
TNIITPRMLNSSAWNWGAKSGFFWAGTCLACAVWTYFRLPEPKGRTYGELDVLFEKRVSARKFSCTPVERFDAED
DGEGGDSSEQEKVGAVMLERVDNNWTGTNSRQRERDLARRQTALNRAAASR*
Coding >Ophun1|2999
ATGGCCAGCAAAGACACCCCCCCAGACGAAAAGGTGGTCAACCTCCTCACCGTCTGCGAAGCCGCCGAAGCCACA
GAAGTCGAACGAAACATGGGCCTCCTCAAGTCCCTGAAAGTGTACAAAAAGGCCTGTCTGTGGTCCATCTTCATC
TCCGTCTGCATCGTCATGGAGGGCTACGACACCGTCATCCTCAACAGTCTGTACGCCTACCCGCCCTTCGTCCGC
GACTTTGGCTCCCGCTCCGGCTCGCACGACGAGTTTGAGATTCCGGCTGCTTGGCAGTCGGGCTTGTCCAACGGG
GCGCTTTGCGGGCAGATTCTCGGACTCTTCTTCAATGGCATTGTTGCCGAGAGGATCGGCTATCGGAAGACGTTG
ATGGGGGCGCTTCTGGCCTGCGTGGGCTTCATTGCCGTCTTGTTCTTTGCCGCTTCGCTTCCTCAGTTGCTCGTT
GGCGAGATCCTCATCGGGATCCCCTGGGGCGTCTTCCAGACCTTGACAACCGCCTACGCAGCAGAGGTCTGTCCG
ACGCACCTCCGCGCCTATCTGACCACCTACATCAACCTCTGCTGGGTAATGGGCCAGTTCATAGCCTCAGGCCTT
CTCCGGGCCATGGTCCCCCGCACCGACCGATGGGGCTACAAGATTCCCTTTGCGGTAGAATGGGCGTGGCCGTTG
CCGCTCGTCGTGGGAATCTGGCTGGCTCCCGAATCGCCCTGGTGGTTGGTACGACATGGTCGGTTCGACGAGGCC
AAGAAGACGGTTGAGCGGTTGACGTCGAGGAATAGCGGCGTTGCCTTTCAACCCGATCAGACGGTTTCCATGATG
ATGCATACGGATGAGATGGAGAGGGAGGCTGTTGCTGGCACTTCCTACCGTGATCTCTTCCGCGGTGCCAACCTC
CGCCGCACGGAAATCGTCTGCGTCACCTGGATGATCCAAACCCTCTGCGGCTCGACCTTTATGAACTACTCAACC
TACTTCTACCACAAGGCCGGCCTGGCCGTCGAGCAATCCTTCAGCATGTCCCTGGCCCAGTACGGCCTCGGCGCC
GTCGGAACACTCACAGCCTGGTTCCTCATGGGTCTCGCCGGCCGGAGAACGCTCTACCTATCGGGCCAGCTCATC
ATGGCCTGCCTCCTCCTGACCATCGGCGTAACAGGCTCGGTAGCAGCCCGAGGCGACAAAGCCGCCCAATGGGCC
ATCGGCTCCATGCTCCTCGTCTACGCCCTCGTCTACAACGCAACCGTCGGTCCCGTCTGCTACTCCCTCGTCTCG
GAGCTGACATCCACCCGCCTCCGCACCAAATCCGTCGTCCTGGCCCGCAACGTCTACAACCTCTCGGGGATAGTC
ACCAACATCATCACCCCCCGGATGCTCAACTCATCCGCCTGGAACTGGGGCGCGAAATCAGGCTTCTTCTGGGCG
GGGACGTGCCTCGCCTGCGCAGTCTGGACCTACTTTCGACTCCCGGAGCCCAAGGGCCGGACGTACGGCGAGCTG
GACGTCCTGTTTGAGAAGCGTGTTAGTGCTCGCAAGTTCAGCTGCACGCCCGTCGAGAGGTTCGACGCCGAGGAT
GACGGGGAAGGCGGTGATTCGTCTGAGCAGGAAAAGGTCGGGGCTGTCATGCTCGAGCGCGTCGATAACAACTGG
ACGGGAACGAATAGCAGGCAGCGAGAAAGGGACCTCGCTCGTCGACAGACGGCCCTGAACCGAGCCGCGGCTTCG
AGATGA
Transcript >Ophun1|2999
ATGGCCAGCAAAGACACCCCCCCAGACGAAAAGGTGGTCAACCTCCTCACCGTCTGCGAAGCCGCCGAAGCCACA
GAAGTCGAACGAAACATGGGCCTCCTCAAGTCCCTGAAAGTGTACAAAAAGGCCTGTCTGTGGTCCATCTTCATC
TCCGTCTGCATCGTCATGGAGGGCTACGACACCGTCATCCTCAACAGTCTGTACGCCTACCCGCCCTTCGTCCGC
GACTTTGGCTCCCGCTCCGGCTCGCACGACGAGTTTGAGATTCCGGCTGCTTGGCAGTCGGGCTTGTCCAACGGG
GCGCTTTGCGGGCAGATTCTCGGACTCTTCTTCAATGGCATTGTTGCCGAGAGGATCGGCTATCGGAAGACGTTG
ATGGGGGCGCTTCTGGCCTGCGTGGGCTTCATTGCCGTCTTGTTCTTTGCCGCTTCGCTTCCTCAGTTGCTCGTT
GGCGAGATCCTCATCGGGATCCCCTGGGGCGTCTTCCAGACCTTGACAACCGCCTACGCAGCAGAGGTCTGTCCG
ACGCACCTCCGCGCCTATCTGACCACCTACATCAACCTCTGCTGGGTAATGGGCCAGTTCATAGCCTCAGGCCTT
CTCCGGGCCATGGTCCCCCGCACCGACCGATGGGGCTACAAGATTCCCTTTGCGGTAGAATGGGCGTGGCCGTTG
CCGCTCGTCGTGGGAATCTGGCTGGCTCCCGAATCGCCCTGGTGGTTGGTACGACATGGTCGGTTCGACGAGGCC
AAGAAGACGGTTGAGCGGTTGACGTCGAGGAATAGCGGCGTTGCCTTTCAACCCGATCAGACGGTTTCCATGATG
ATGCATACGGATGAGATGGAGAGGGAGGCTGTTGCTGGCACTTCCTACCGTGATCTCTTCCGCGGTGCCAACCTC
CGCCGCACGGAAATCGTCTGCGTCACCTGGATGATCCAAACCCTCTGCGGCTCGACCTTTATGAACTACTCAACC
TACTTCTACCACAAGGCCGGCCTGGCCGTCGAGCAATCCTTCAGCATGTCCCTGGCCCAGTACGGCCTCGGCGCC
GTCGGAACACTCACAGCCTGGTTCCTCATGGGTCTCGCCGGCCGGAGAACGCTCTACCTATCGGGCCAGCTCATC
ATGGCCTGCCTCCTCCTGACCATCGGCGTAACAGGCTCGGTAGCAGCCCGAGGCGACAAAGCCGCCCAATGGGCC
ATCGGCTCCATGCTCCTCGTCTACGCCCTCGTCTACAACGCAACCGTCGGTCCCGTCTGCTACTCCCTCGTCTCG
GAGCTGACATCCACCCGCCTCCGCACCAAATCCGTCGTCCTGGCCCGCAACGTCTACAACCTCTCGGGGATAGTC
ACCAACATCATCACCCCCCGGATGCTCAACTCATCCGCCTGGAACTGGGGCGCGAAATCAGGCTTCTTCTGGGCG
GGGACGTGCCTCGCCTGCGCAGTCTGGACCTACTTTCGACTCCCGGAGCCCAAGGGCCGGACGTACGGCGAGCTG
GACGTCCTGTTTGAGAAGCGTGTTAGTGCTCGCAAGTTCAGCTGCACGCCCGTCGAGAGGTTCGACGCCGAGGAT
GACGGGGAAGGCGGTGATTCGTCTGAGCAGGAAAAGGTCGGGGCTGTCATGCTCGAGCGCGTCGATAACAACTGG
ACGGGAACGAATAGCAGGCAGCGAGAAAGGGACCTCGCTCGTCGACAGACGGCCCTGAACCGAGCCGCGGCTTCG
AGATGA
Gene >Ophun1|2999
ATGGCCAGCAAAGACACCCCCCCAGACGAAAAGGTGGTCAACCTCCTCACCGTCTGCGAAGCCGCCGAAGCCACA
GAAGTCGAACGAAACATGGGCCTCCTCAAGTCCCTGAAAGTGTACAAAAAGGCCTGTCTGTGGTCCATCTTCATC
TCCGTCTGCATCGTCATGGAGGGCTACGACACCGTCATCCTCAACAGTCTGTACGCCTACCCGCCCTTCGTCCGC
GACTTTGGCTCCCGCTCCGGCTCGCACGACGAGTTTGAGATTCCGGCTGCTTGGCAGTCGGGCTTGTCCAACGGG
GCGCTTTGCGGGCAGATTCTCGGACTCTTCTTCAATGGCATTGTTGCCGAGAGGATCGGCTATCGGAAGACGTTG
ATGGGGGCGCTTCTGGCCTGCGTGGGCTTCATTGCCGTCTTGTTCTTTGCCGCTTCGCTTCCTCAGTTGCTCGTT
GGCGAGATCCTCATCGGGATCCCCTGGGGCGTCTTCCAGACCTTGACAACCGCCTACGCAGCAGAGGTCTGTCCG
ACGCACCTCCGCGCCTATCTGACCACCTACATCAACCTCTGCTGGGTAATGGGCCAGTTCATAGCCTCAGGCCTT
CTCCGGGCCATGGTCCCCCGCACCGACCGATGGGGCTACAAGATTCCCTTTGCGGTAGAATGGGCGTGGCCGTTG
CCGCTCGTCGTGGGAATCTGGCTGGCTCCCGAATCGCCCTGGTGGTTGGTACGACATGGTCGGTTCGACGAGGCC
AAGAAGACGGTTGAGCGGTTGACGTCGAGGAATAGCGGCGTTGCCTTTCAACCCGATCAGACGGTTTCCATGATG
ATGCATACGGATGAGATGGAGAGGGAGGCTGTTGCTGGCACTTCCTACCGTGATCTCTTCCGCGGTGCCAACCTC
CGCCGCACGGAAATCGTCTGCGTCACCTGGATGATCCAAACCCTCTGCGGCTCGACCTTTATGAACTACTCAACC
TACTTCTACCACAAGGCCGGCCTGGCCGTCGAGCAATCCTTCAGCATGTCCCTGGCCCAGTACGGCCTCGGCGCC
GTCGGAACACTCACAGCCTGGTTCCTCATGGGTCTCGCCGGCCGGAGAACGCTCTACCTATCGGGCCAGCTCATC
ATGGCCTGCCTCCTCCTGACCATCGGCGTAACAGGCTCGGTAGCAGCCCGAGGCGACAAAGCCGCCCAATGGGCC
ATCGGCTCCATGCTCCTCGTCTACGCCCTCGTCTACAACGCAACCGTCGGTCCCGTCTGCTACTCCCTCGTCTCG
GAGCTGACATCCACCCGCCTCCGCACCAAATCCGTCGTCCTGGCCCGCAACGTCTACAACCTCTCGGGGATAGTC
ACCAACATCATCACCCCCCGGATGCTCAACTCATCCGCCTGGAACTGGGGCGCGAAATCAGGCTTCTTCTGGGCG
GGGACGTGCCTCGCCTGCGCAGTCTGGACCTACTTTCGACTCCCGGAGCCCAAGGGCCGGACGTACGGCGAGCTG
GACGTCCTGTTTGAGAAGCGTGTTAGTGCTCGCAAGTTCAGCTGCACGCCCGTCGAGAGGTTCGACGCCGAGGAT
GACGGGGAAGGCGGTGATTCGTCTGAGCAGGAAAAGGTCGGGGCTGTCATGCTCGAGCGCGTCGATAACAACTGG
ACGGGAACGAATAGCAGGCAGCGAGAAAGGGACCTCGCTCGTCGACAGACGGCCCTGAACCGAGCCGCGGCTTCG
AGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail