Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2995
Gene name
LocationContig_266:16941..19170
Strand+
Gene length (bp)2229
Transcript length (bp)2229
Coding sequence length (bp)2229
Protein length (aa) 743

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03152 UFD1 Ubiquitin fusion degradation protein UFD1 2.9E-20 75 225
PF16558 AZUL Amino-terminal Zinc-binding domain of ubiquitin ligase E3A 2.2E-06 629 667

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q19584|UFD1_CAEEL Ubiquitin fusion degradation protein 1 homolog OS=Caenorhabditis elegans GN=ufd-1 PE=3 SV=1 15 242 1.0E-10
sp|P53044|UFD1_YEAST Ubiquitin fusion degradation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD1 PE=1 SV=1 79 234 3.0E-09
sp|Q58D05|TRAD1_BOVIN TRAF-type zinc finger domain-containing protein 1 OS=Bos taurus GN=TRAFD1 PE=2 SV=1 398 556 2.0E-06
sp|Q3UDK1|TRAD1_MOUSE TRAF-type zinc finger domain-containing protein 1 OS=Mus musculus GN=Trafd1 PE=1 SV=1 402 556 4.0E-06

GO

GO Term Description Terminal node
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0019538 protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006508 proteolysis No
GO:0009056 catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2995
MDASPPLHWSATYDFLPAPSPDSKLPAGDKIILPQSALEQLLAASPSSIPLRDSHDGSPYGSNPYYSGFIGDDSQ
QLPHPLMFCLLNPANGKTVYAGIREFSAPEGTLALSPFLSESLGFGVPEADVDANAAAVLASPSQVVVVARQLPK
GTYARLRPLEAGYNPDDWRSLLERHLRQNLTCLTKDAVLSVPGVRGETFKFRVDKIAPDGDGICVVDTDLEVDIE
ALDEEQARETLRQIISKEHVTTANGSSEGGELMFQKAVQGHVSPGAYVDYHLRSWDRSRPLSITLSGLAGEDSPD
LFVTPKSTRQRALPRDSVYVLGHFGAADHGVKSLSLDATDAASDSVESILISVHSYRSSGAPRQTSEPIKFELRA
HVTSDSDDAGGKTDGDEQNHSADEERCANCLRWVPTRTMVLHANFCRRNNVVCSKCQAVFVKSSPEWEAHWHCDD
DDAHGNSTADKARHIQVFHGHHDCPSCEFSSNSLPDLARHRTSVCPGKLILCRFCHLEVAQGGDAFNPSPEVVLT
GMTAHELQDGARTTECHLCDKIVRLRDMETHLKHHELDKVRRLKPPICRNASCGRTLDGVGPRGQVGGQGGKESS
NDMGLCSLCFGPLYVSLHDPDGKALRRRIERRYLGQLMSGCGKSHCGNAWCKTGRANSGLEPRGSSAQAALPLVK
PLMERLPERDEPMFFCVDETSQRQRTVAELVAAEKGWELEWCVAAAEAEKGDVNKMREWLQAWAPRR*
Coding >Ophun1|2995
ATGGACGCCTCCCCGCCTCTCCACTGGTCCGCCACCTACGATTTCCTGCCCGCCCCTTCGCCCGACTCCAAGCTC
CCAGCGGGCGATAAGATCATTCTTCCACAGTCGGCGCTTGAGCAGCTTCTCGCGGCCTCTCCATCATCTATCCCG
TTGCGGGATTCCCATGATGGCTCGCCTTACGGCTCCAACCCGTACTACTCCGGCTTCATCGGCGACGACTCCCAG
CAACTTCCCCATCCGCTCATGTTCTGTCTGCTGAATCCTGCCAACGGGAAGACGGTCTACGCCGGCATTCGCGAG
TTTTCTGCGCCGGAGGGAACGTTGGCTCTCAGTCCGTTTCTCTCTGAATCACTAGGTTTCGGCGTCCCAGAGGCT
GACGTCGACGCCAACGCTGCTGCTGTGCTGGCATCGCCTTCGCAGGTCGTTGTTGTCGCTCGACAACTTCCGAAA
GGTACTTACGCTCGCTTGCGACCGCTCGAAGCGGGCTATAACCCCGATGACTGGAGGTCTTTGTTGGAGCGTCAC
TTGCGACAGAACCTGACCTGCCTCACCAAGGATGCTGTCCTTTCCGTGCCTGGCGTCCGCGGCGAAACCTTCAAG
TTCCGGGTTGATAAAATCGCACCGGACGGTGACGGAATCTGCGTCGTCGACACCGACCTCGAGGTCGACATTGAA
GCCCTTGACGAGGAGCAGGCGAGAGAGACGTTGCGGCAGATAATATCCAAGGAGCACGTCACCACCGCCAACGGA
AGTTCCGAGGGCGGCGAGCTGATGTTTCAAAAGGCTGTGCAGGGACATGTCTCGCCCGGTGCCTATGTTGACTAC
CATCTGCGGTCGTGGGACCGATCACGACCGCTCAGCATAACGCTCAGCGGACTCGCGGGAGAGGACAGCCCCGAC
CTCTTTGTCACACCCAAGTCGACTCGACAACGTGCTTTGCCGCGCGACTCGGTTTATGTCTTGGGACACTTTGGC
GCCGCAGACCACGGCGTCAAGAGCCTTTCGCTCGATGCTACGGACGCCGCGTCTGACAGCGTAGAATCCATCCTT
ATATCGGTTCACTCTTACCGGTCCTCCGGAGCGCCACGGCAGACCTCGGAGCCGATCAAATTTGAGCTCCGAGCT
CATGTGACGTCGGATTCGGACGATGCCGGGGGGAAAACAGACGGTGACGAGCAAAACCACAGCGCGGACGAAGAG
CGGTGCGCCAATTGTCTGCGTTGGGTGCCGACGCGGACCATGGTTCTTCACGCAAACTTTTGTCGCAGGAATAAC
GTCGTTTGCTCCAAGTGCCAGGCCGTCTTTGTCAAGAGCTCACCCGAGTGGGAAGCACACTGGCATTGCGACGAC
GATGACGCGCACGGAAACTCGACGGCCGATAAGGCGAGGCACATTCAGGTGTTTCACGGCCATCACGATTGCCCG
TCGTGCGAGTTCTCTTCCAACTCTTTACCGGATCTCGCGAGACATCGGACGAGCGTCTGCCCCGGCAAGTTGATA
CTCTGTCGCTTCTGCCACCTCGAGGTGGCGCAAGGAGGGGACGCCTTCAACCCGTCACCCGAGGTCGTCCTGACC
GGCATGACGGCTCACGAGCTGCAGGACGGGGCACGCACGACGGAGTGCCATTTGTGCGACAAGATCGTTCGACTC
CGAGACATGGAGACGCATCTCAAGCACCACGAGCTGGACAAGGTGAGGCGTCTGAAGCCTCCGATTTGCCGCAAC
GCGAGCTGCGGTAGAACCTTGGACGGTGTGGGACCCCGTGGTCAGGTCGGGGGACAGGGCGGCAAGGAATCAAGC
AACGACATGGGACTATGCTCGCTGTGCTTCGGACCGCTGTACGTCAGTCTCCACGATCCGGACGGCAAGGCGCTG
CGGAGGAGAATCGAGAGGCGATATCTCGGGCAGCTGATGAGCGGCTGCGGCAAGTCTCACTGCGGCAACGCGTGG
TGCAAGACGGGCAGGGCCAACAGCGGCCTAGAGCCACGGGGATCGTCTGCACAGGCGGCGCTGCCACTGGTCAAG
CCGCTTATGGAGAGGCTTCCGGAACGCGATGAGCCCATGTTCTTCTGCGTCGACGAGACGAGCCAGAGGCAGCGG
ACGGTGGCCGAGCTGGTTGCTGCCGAGAAGGGATGGGAGCTGGAGTGGTGCGTGGCGGCGGCCGAGGCGGAGAAG
GGCGACGTGAACAAGATGCGGGAGTGGCTGCAGGCGTGGGCACCGAGGAGATGA
Transcript >Ophun1|2995
ATGGACGCCTCCCCGCCTCTCCACTGGTCCGCCACCTACGATTTCCTGCCCGCCCCTTCGCCCGACTCCAAGCTC
CCAGCGGGCGATAAGATCATTCTTCCACAGTCGGCGCTTGAGCAGCTTCTCGCGGCCTCTCCATCATCTATCCCG
TTGCGGGATTCCCATGATGGCTCGCCTTACGGCTCCAACCCGTACTACTCCGGCTTCATCGGCGACGACTCCCAG
CAACTTCCCCATCCGCTCATGTTCTGTCTGCTGAATCCTGCCAACGGGAAGACGGTCTACGCCGGCATTCGCGAG
TTTTCTGCGCCGGAGGGAACGTTGGCTCTCAGTCCGTTTCTCTCTGAATCACTAGGTTTCGGCGTCCCAGAGGCT
GACGTCGACGCCAACGCTGCTGCTGTGCTGGCATCGCCTTCGCAGGTCGTTGTTGTCGCTCGACAACTTCCGAAA
GGTACTTACGCTCGCTTGCGACCGCTCGAAGCGGGCTATAACCCCGATGACTGGAGGTCTTTGTTGGAGCGTCAC
TTGCGACAGAACCTGACCTGCCTCACCAAGGATGCTGTCCTTTCCGTGCCTGGCGTCCGCGGCGAAACCTTCAAG
TTCCGGGTTGATAAAATCGCACCGGACGGTGACGGAATCTGCGTCGTCGACACCGACCTCGAGGTCGACATTGAA
GCCCTTGACGAGGAGCAGGCGAGAGAGACGTTGCGGCAGATAATATCCAAGGAGCACGTCACCACCGCCAACGGA
AGTTCCGAGGGCGGCGAGCTGATGTTTCAAAAGGCTGTGCAGGGACATGTCTCGCCCGGTGCCTATGTTGACTAC
CATCTGCGGTCGTGGGACCGATCACGACCGCTCAGCATAACGCTCAGCGGACTCGCGGGAGAGGACAGCCCCGAC
CTCTTTGTCACACCCAAGTCGACTCGACAACGTGCTTTGCCGCGCGACTCGGTTTATGTCTTGGGACACTTTGGC
GCCGCAGACCACGGCGTCAAGAGCCTTTCGCTCGATGCTACGGACGCCGCGTCTGACAGCGTAGAATCCATCCTT
ATATCGGTTCACTCTTACCGGTCCTCCGGAGCGCCACGGCAGACCTCGGAGCCGATCAAATTTGAGCTCCGAGCT
CATGTGACGTCGGATTCGGACGATGCCGGGGGGAAAACAGACGGTGACGAGCAAAACCACAGCGCGGACGAAGAG
CGGTGCGCCAATTGTCTGCGTTGGGTGCCGACGCGGACCATGGTTCTTCACGCAAACTTTTGTCGCAGGAATAAC
GTCGTTTGCTCCAAGTGCCAGGCCGTCTTTGTCAAGAGCTCACCCGAGTGGGAAGCACACTGGCATTGCGACGAC
GATGACGCGCACGGAAACTCGACGGCCGATAAGGCGAGGCACATTCAGGTGTTTCACGGCCATCACGATTGCCCG
TCGTGCGAGTTCTCTTCCAACTCTTTACCGGATCTCGCGAGACATCGGACGAGCGTCTGCCCCGGCAAGTTGATA
CTCTGTCGCTTCTGCCACCTCGAGGTGGCGCAAGGAGGGGACGCCTTCAACCCGTCACCCGAGGTCGTCCTGACC
GGCATGACGGCTCACGAGCTGCAGGACGGGGCACGCACGACGGAGTGCCATTTGTGCGACAAGATCGTTCGACTC
CGAGACATGGAGACGCATCTCAAGCACCACGAGCTGGACAAGGTGAGGCGTCTGAAGCCTCCGATTTGCCGCAAC
GCGAGCTGCGGTAGAACCTTGGACGGTGTGGGACCCCGTGGTCAGGTCGGGGGACAGGGCGGCAAGGAATCAAGC
AACGACATGGGACTATGCTCGCTGTGCTTCGGACCGCTGTACGTCAGTCTCCACGATCCGGACGGCAAGGCGCTG
CGGAGGAGAATCGAGAGGCGATATCTCGGGCAGCTGATGAGCGGCTGCGGCAAGTCTCACTGCGGCAACGCGTGG
TGCAAGACGGGCAGGGCCAACAGCGGCCTAGAGCCACGGGGATCGTCTGCACAGGCGGCGCTGCCACTGGTCAAG
CCGCTTATGGAGAGGCTTCCGGAACGCGATGAGCCCATGTTCTTCTGCGTCGACGAGACGAGCCAGAGGCAGCGG
ACGGTGGCCGAGCTGGTTGCTGCCGAGAAGGGATGGGAGCTGGAGTGGTGCGTGGCGGCGGCCGAGGCGGAGAAG
GGCGACGTGAACAAGATGCGGGAGTGGCTGCAGGCGTGGGCACCGAGGAGATGA
Gene >Ophun1|2995
ATGGACGCCTCCCCGCCTCTCCACTGGTCCGCCACCTACGATTTCCTGCCCGCCCCTTCGCCCGACTCCAAGCTC
CCAGCGGGCGATAAGATCATTCTTCCACAGTCGGCGCTTGAGCAGCTTCTCGCGGCCTCTCCATCATCTATCCCG
TTGCGGGATTCCCATGATGGCTCGCCTTACGGCTCCAACCCGTACTACTCCGGCTTCATCGGCGACGACTCCCAG
CAACTTCCCCATCCGCTCATGTTCTGTCTGCTGAATCCTGCCAACGGGAAGACGGTCTACGCCGGCATTCGCGAG
TTTTCTGCGCCGGAGGGAACGTTGGCTCTCAGTCCGTTTCTCTCTGAATCACTAGGTTTCGGCGTCCCAGAGGCT
GACGTCGACGCCAACGCTGCTGCTGTGCTGGCATCGCCTTCGCAGGTCGTTGTTGTCGCTCGACAACTTCCGAAA
GGTACTTACGCTCGCTTGCGACCGCTCGAAGCGGGCTATAACCCCGATGACTGGAGGTCTTTGTTGGAGCGTCAC
TTGCGACAGAACCTGACCTGCCTCACCAAGGATGCTGTCCTTTCCGTGCCTGGCGTCCGCGGCGAAACCTTCAAG
TTCCGGGTTGATAAAATCGCACCGGACGGTGACGGAATCTGCGTCGTCGACACCGACCTCGAGGTCGACATTGAA
GCCCTTGACGAGGAGCAGGCGAGAGAGACGTTGCGGCAGATAATATCCAAGGAGCACGTCACCACCGCCAACGGA
AGTTCCGAGGGCGGCGAGCTGATGTTTCAAAAGGCTGTGCAGGGACATGTCTCGCCCGGTGCCTATGTTGACTAC
CATCTGCGGTCGTGGGACCGATCACGACCGCTCAGCATAACGCTCAGCGGACTCGCGGGAGAGGACAGCCCCGAC
CTCTTTGTCACACCCAAGTCGACTCGACAACGTGCTTTGCCGCGCGACTCGGTTTATGTCTTGGGACACTTTGGC
GCCGCAGACCACGGCGTCAAGAGCCTTTCGCTCGATGCTACGGACGCCGCGTCTGACAGCGTAGAATCCATCCTT
ATATCGGTTCACTCTTACCGGTCCTCCGGAGCGCCACGGCAGACCTCGGAGCCGATCAAATTTGAGCTCCGAGCT
CATGTGACGTCGGATTCGGACGATGCCGGGGGGAAAACAGACGGTGACGAGCAAAACCACAGCGCGGACGAAGAG
CGGTGCGCCAATTGTCTGCGTTGGGTGCCGACGCGGACCATGGTTCTTCACGCAAACTTTTGTCGCAGGAATAAC
GTCGTTTGCTCCAAGTGCCAGGCCGTCTTTGTCAAGAGCTCACCCGAGTGGGAAGCACACTGGCATTGCGACGAC
GATGACGCGCACGGAAACTCGACGGCCGATAAGGCGAGGCACATTCAGGTGTTTCACGGCCATCACGATTGCCCG
TCGTGCGAGTTCTCTTCCAACTCTTTACCGGATCTCGCGAGACATCGGACGAGCGTCTGCCCCGGCAAGTTGATA
CTCTGTCGCTTCTGCCACCTCGAGGTGGCGCAAGGAGGGGACGCCTTCAACCCGTCACCCGAGGTCGTCCTGACC
GGCATGACGGCTCACGAGCTGCAGGACGGGGCACGCACGACGGAGTGCCATTTGTGCGACAAGATCGTTCGACTC
CGAGACATGGAGACGCATCTCAAGCACCACGAGCTGGACAAGGTGAGGCGTCTGAAGCCTCCGATTTGCCGCAAC
GCGAGCTGCGGTAGAACCTTGGACGGTGTGGGACCCCGTGGTCAGGTCGGGGGACAGGGCGGCAAGGAATCAAGC
AACGACATGGGACTATGCTCGCTGTGCTTCGGACCGCTGTACGTCAGTCTCCACGATCCGGACGGCAAGGCGCTG
CGGAGGAGAATCGAGAGGCGATATCTCGGGCAGCTGATGAGCGGCTGCGGCAAGTCTCACTGCGGCAACGCGTGG
TGCAAGACGGGCAGGGCCAACAGCGGCCTAGAGCCACGGGGATCGTCTGCACAGGCGGCGCTGCCACTGGTCAAG
CCGCTTATGGAGAGGCTTCCGGAACGCGATGAGCCCATGTTCTTCTGCGTCGACGAGACGAGCCAGAGGCAGCGG
ACGGTGGCCGAGCTGGTTGCTGCCGAGAAGGGATGGGAGCTGGAGTGGTGCGTGGCGGCGGCCGAGGCGGAGAAG
GGCGACGTGAACAAGATGCGGGAGTGGCTGCAGGCGTGGGCACCGAGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail