Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2989
Gene name
LocationContig_266:3582..4569
Strand+
Gene length (bp)987
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 5.5E-28 31 304

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2U1X8|ABNC_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnC PE=3 SV=1 40 321 5.0E-08
sp|B8NMD3|ABNC_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnC PE=3 SV=2 40 321 5.0E-08
sp|A5IKD4|EABN_THEP1 Extracellular endo-alpha-(1->5)-L-arabinanase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0637 PE=1 SV=1 40 268 1.0E-06
sp|P42293|EABN2_BACSU Extracellular endo-alpha-(1->5)-L-arabinanase 2 OS=Bacillus subtilis (strain 168) GN=abn2 PE=1 SV=2 8 283 3.0E-06

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999773

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH43_30 8.3E-87 37 313

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5465
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01656
Ophiocordyceps camponoti-rufipedis Ophun1|2989 (this protein)
Ophiocordyceps kimflemingae Ophio5|2133
Ophiocordyceps subramaniannii Hirsu2|6322

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2989
MLLELGAVFGLGCLSTLVEAAVPAPVIQPYKPVLHNDFPDPSIIQGPDNMFYAFATTGGDRVVQVQAARAPSPTG
PWQHLTDTSVLPNSGPAFTGQNTWAPDVQRLDDGSYVLYFSGQLASKPDHHCVGAATSRSILGPYVPQQQPFACD
VGVGGQIDPSGFRDADGRRYVVYKVDGNSLGNGGQCKNGIAPRRATPIELQEVGPNGIDKIGPPIQILDRVGDEP
LVEAPDLYRAPDGTYVLFFSSGCFTDPSYNVHYATSRSVRGPFTRAAKPLLVSNDVRGLVAPGGASVLAGGENLV
FHANCDVGRCMYQKRYRFRDGSIRLMLT*
Coding >Ophun1|2989
ATGCTGCTCGAGCTCGGTGCCGTCTTCGGCCTCGGCTGCCTCTCGACTCTGGTCGAGGCCGCGGTGCCGGCGCCC
GTCATCCAGCCCTATAAGCCGGTGCTGCACAACGACTTTCCCGATCCCAGCATCATCCAGGGCCCGGACAACATG
TTTTACGCCTTTGCCACCACCGGAGGCGACAGGGTCGTTCAGGTCCAGGCAGCAAGAGCACCGTCTCCGACGGGC
CCCTGGCAGCATCTTACAGATACCAGCGTGCTGCCCAACTCGGGACCGGCCTTTACGGGCCAGAATACGTGGGCG
CCTGATGTTCAACGGCTTGATGACGGCTCCTACGTTCTCTACTTTAGCGGTCAGCTGGCCAGCAAACCGGATCAT
CACTGCGTCGGCGCCGCCACAAGCCGCTCGATCCTCGGCCCTTACGTTCCTCAGCAGCAGCCATTCGCTTGCGAC
GTCGGTGTCGGCGGTCAGATCGATCCTTCAGGCTTCCGCGATGCCGACGGAAGACGCTACGTCGTCTACAAGGTC
GACGGAAACAGCCTGGGCAACGGCGGTCAGTGCAAGAACGGCATCGCGCCTCGGAGAGCGACGCCCATTGAGCTG
CAAGAGGTTGGGCCCAATGGCATCGATAAGATCGGACCGCCGATTCAGATCCTCGACCGCGTTGGCGACGAGCCC
CTAGTCGAAGCCCCGGATCTATACCGCGCCCCGGACGGCACTTATGTTCTCTTTTTCAGCTCCGGATGCTTCACC
GATCCGAGCTACAACGTTCACTACGCTACGAGCCGCAGCGTCAGGGGTCCCTTTACGCGCGCGGCCAAGCCTCTG
CTCGTCTCCAACGATGTCCGTGGCTTGGTTGCCCCCGGAGGCGCTTCCGTGCTGGCCGGGGGGGAGAACCTGGTC
TTTCATGCCAACTGCGATGTTGGGCGGTGCATGTATCAGAAGAGATACCGGTTCCGGGATGGGTCGATTAGGTTG
ATGCTGACTTGA
Transcript >Ophun1|2989
ATGCTGCTCGAGCTCGGTGCCGTCTTCGGCCTCGGCTGCCTCTCGACTCTGGTCGAGGCCGCGGTGCCGGCGCCC
GTCATCCAGCCCTATAAGCCGGTGCTGCACAACGACTTTCCCGATCCCAGCATCATCCAGGGCCCGGACAACATG
TTTTACGCCTTTGCCACCACCGGAGGCGACAGGGTCGTTCAGGTCCAGGCAGCAAGAGCACCGTCTCCGACGGGC
CCCTGGCAGCATCTTACAGATACCAGCGTGCTGCCCAACTCGGGACCGGCCTTTACGGGCCAGAATACGTGGGCG
CCTGATGTTCAACGGCTTGATGACGGCTCCTACGTTCTCTACTTTAGCGGTCAGCTGGCCAGCAAACCGGATCAT
CACTGCGTCGGCGCCGCCACAAGCCGCTCGATCCTCGGCCCTTACGTTCCTCAGCAGCAGCCATTCGCTTGCGAC
GTCGGTGTCGGCGGTCAGATCGATCCTTCAGGCTTCCGCGATGCCGACGGAAGACGCTACGTCGTCTACAAGGTC
GACGGAAACAGCCTGGGCAACGGCGGTCAGTGCAAGAACGGCATCGCGCCTCGGAGAGCGACGCCCATTGAGCTG
CAAGAGGTTGGGCCCAATGGCATCGATAAGATCGGACCGCCGATTCAGATCCTCGACCGCGTTGGCGACGAGCCC
CTAGTCGAAGCCCCGGATCTATACCGCGCCCCGGACGGCACTTATGTTCTCTTTTTCAGCTCCGGATGCTTCACC
GATCCGAGCTACAACGTTCACTACGCTACGAGCCGCAGCGTCAGGGGTCCCTTTACGCGCGCGGCCAAGCCTCTG
CTCGTCTCCAACGATGTCCGTGGCTTGGTTGCCCCCGGAGGCGCTTCCGTGCTGGCCGGGGGGGAGAACCTGGTC
TTTCATGCCAACTGCGATGTTGGGCGGTGCATGTATCAGAAGAGATACCGGTTCCGGGATGGGTCGATTAGGTTG
ATGCTGACTTGA
Gene >Ophun1|2989
ATGCTGCTCGAGCTCGGTGCCGTCTTCGGCCTCGGCTGCCTCTCGACTCTGGTCGAGGCCGCGGTGCCGGCGCCC
GTCATCCAGCCCTATAAGCCGGTGCTGCACAACGACTTTCCCGATCCCAGCATCATCCAGGGCCCGGACAACATG
TTTTACGCCTTTGCCACCACCGGAGGCGACAGGGTCGTTCAGGTCCAGGCAGCAAGAGCACCGTCTCCGACGGGC
CCCTGGCAGCATCTTACAGATACCAGCGTGCTGCCCAACTCGGGACCGGCCTTTACGGGCCAGAATACGTGGGCG
CCTGATGTTCAACGGCTTGATGACGGCTCCTACGTTCTCTACTTTAGCGGTCAGCTGGCCAGCAAACCGGATCAT
CACTGCGTCGGCGCCGCCACAAGCCGCTCGATCCTCGGCCCTTACGTTCCTCAGCAGCAGCCATTCGCTTGCGAC
GTCGGTGTCGGCGGTCAGATCGATCCTTCAGGCTTCCGCGATGCCGACGGAAGACGCTACGTCGTCTACAAGGTC
GACGGAAACAGCCTGGGCAACGGCGGTCAGTGCAAGAACGGCATCGCGCCTCGGAGAGCGACGCCCATTGAGCTG
CAAGAGGTTGGGCCCAATGGCATCGATAAGATCGGACCGCCGATTCAGATCCTCGACCGCGTTGGCGACGAGCCC
CTAGTCGAAGCCCCGGATCTATACCGCGCCCCGGACGGCACTTATGTTCTCTTTTTCAGCTCCGGATGCTTCACC
GATCCGAGCTACAACGTTCACTACGCTACGAGCCGCAGCGTCAGGGGTCCCTTTACGCGCGCGGCCAAGCCTCTG
CTCGTCTCCAACGATGTCCGTGGCTTGGTTGCCCCCGGAGGCGCTTCCGTGCTGGCCGGGGGGGAGAACCTGGTC
TTTCATGCCAACTGCGATGTTGGGCGGTGCATGTATCAGAAGAGATACCGGTTCCGGGATGGGTCGATTAGGTTG
ATGCTGACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail