Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2988
Gene name
LocationContig_266:510..2101
Strand+
Gene length (bp)1591
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.6E-26 48 363

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 10 471 2.0E-142
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 15 443 3.0E-52
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 4 471 4.0E-42
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 9 471 4.0E-39
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 3 460 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 10 471 2.0E-142
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 15 443 3.0E-52
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 4 471 4.0E-42
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 9 471 4.0E-39
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 3 460 1.0E-37
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 22 443 1.0E-30
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 20 444 6.0E-30
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 16 442 2.0E-25
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 18 442 8.0E-23
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 22 469 3.0E-22
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 8 451 6.0E-22
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 31 329 2.0E-18
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 22 315 7.0E-17
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 28 457 3.0E-16
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 52 413 7.0E-16
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 15 323 3.0E-15
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 15 456 4.0E-15
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 51 460 4.0E-15
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 24 322 1.0E-14
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 56 413 2.0E-13
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 13 460 1.0E-12
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 116 310 4.0E-10
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 16 241 7.0E-09
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 63 262 1.0E-08
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 118 237 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 87 109 22
3 113 135 22
4 147 169 22
5 179 201 22
6 255 277 22
7 287 309 22
8 316 335 19
9 345 367 22
10 379 401 22
11 411 433 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2988
MASSPAKDEPIVETDSHVVETDPRVTDHAAERKLCFKFDLRILPVLALLYLNFQPGQYNTIISIFFIPFVLFAPP
FSILSRRFGPARALPVMTALFGTVTLVTASARSFGPVLALRWLLGMSEAAFYPVAIYYLTTFYRRAELARRLAIL
SASVGVANGFSGLLAFALFRVPAGPLLFSWRYLFLVEGAASVVLAVVAFFVLPRSAAEASFLNETERALALRRIR
LDSSSGNTSDRPRKLSDALSILTHPTSIAFLAIEICVGVPLQAVALFMPQIIQRLGYSTVQTNLLTVAPNATGSV
ALLLLAFASDASRLRFPLVVLAFSLTLTGFVVYAAIGDVGKSLRLAYAATFIMCWGSVAPSVLLSTWYNNNVADD
GRRLVLTSVGVPLANLMGLVSANVFRERDAPKYTPALITTACFGGAGALISACLGLYMVFDNRRRDRRDGVSLRA
RDVPTQRLRDGPSVREFRWFL*
Coding >Ophun1|2988
ATGGCCAGCTCCCCAGCAAAAGACGAGCCCATCGTCGAAACAGACTCCCACGTCGTAGAGACAGACCCCCGCGTC
ACAGACCACGCCGCCGAGCGAAAACTCTGCTTCAAATTCGACCTCCGTATCCTCCCCGTCCTCGCCCTCCTCTAC
CTCAACTTCCAACCAGGCCAGTACAACACCATCATCTCAATCTTCTTCATTCCCTTCGTCCTCTTCGCACCCCCC
TTCTCAATCCTAAGCCGCCGCTTCGGTCCTGCCAGAGCCCTCCCCGTCATGACGGCCCTCTTCGGCACCGTCACC
CTCGTCACCGCCTCCGCCCGCTCCTTCGGCCCCGTCCTCGCCCTCCGATGGCTCCTGGGAATGTCCGAGGCCGCT
TTCTACCCCGTTGCCATCTACTACCTCACTACCTTTTACCGACGGGCTGAGCTTGCGCGTCGGCTGGCCATCCTG
TCGGCGTCTGTGGGGGTGGCCAATGGGTTTAGTGGCTTGTTGGCCTTTGCGCTGTTTCGTGTCCCGGCTGGGCCG
TTGTTGTTCTCATGGCGATATCTGTTTCTCGTTGAGGGGGCTGCTTCGGTCGTGCTGGCAGTTGTGGCCTTTTTC
GTCTTGCCCAGGTCTGCTGCTGAGGCGAGCTTCCTGAACGAAACAGAGCGAGCTCTGGCCCTCCGTCGAATCCGT
CTCGACTCGTCGTCCGGAAACACCTCAGACCGACCCAGGAAGCTATCCGATGCCCTCAGCATCCTCACCCACCCG
ACATCGATAGCCTTTCTCGCCATCGAGATATGTGTGGGCGTACCTCTTCAGGCGGTAGCCCTCTTCATGCCGCAG
ATCATCCAGCGGCTGGGCTACTCGACCGTTCAGACCAACCTGTTGACCGTCGCGCCCAATGCTACCGGTTCCGTC
GCCCTGCTTCTACTGGCTTTCGCCTCGGATGCTTCGAGGTTGCGGTTTCCGTTGGTCGTCCTGGCTTTCTCGTTG
ACGCTTACGGGTTTCGTCGTCTACGCTGCCATCGGTGACGTCGGCAAGAGTCTCAGGCTGGCGTACGCTGCCACC
TTCATCATGTGTTGGGGATCCGTCGCGCCTTCAGTCCTCCTCTCAACCTGGTATAATAACAACGTTGCTGACGAT
GGACGCCGTCTTGTCCTGACGTCTGTTGGTGTCCCGCTCGCCAACCTCATGGGCCTCGTCTCAGCCAACGTCTTC
CGCGAGCGGGATGCGCCAAAGTATACGCCTGCCCTCATCACTACTGCCTGTTTCGGCGGTGCTGGCGCTCTGATA
TCTGCTTGTCTTGGTCTCTACATGGTGTTTGATAATAGGCGGCGCGATAGGAGGGATGGAGTGAGTCTGAGGGCG
CGCGATGTGCCGACTCAACGGCTTAGAGATGGACCCAGCGTGCGGGAATTCCGCTGGTTTCTCTAG
Transcript >Ophun1|2988
ATGGCCAGCTCCCCAGCAAAAGACGAGCCCATCGTCGAAACAGACTCCCACGTCGTAGAGACAGACCCCCGCGTC
ACAGACCACGCCGCCGAGCGAAAACTCTGCTTCAAATTCGACCTCCGTATCCTCCCCGTCCTCGCCCTCCTCTAC
CTCAACTTCCAACCAGGCCAGTACAACACCATCATCTCAATCTTCTTCATTCCCTTCGTCCTCTTCGCACCCCCC
TTCTCAATCCTAAGCCGCCGCTTCGGTCCTGCCAGAGCCCTCCCCGTCATGACGGCCCTCTTCGGCACCGTCACC
CTCGTCACCGCCTCCGCCCGCTCCTTCGGCCCCGTCCTCGCCCTCCGATGGCTCCTGGGAATGTCCGAGGCCGCT
TTCTACCCCGTTGCCATCTACTACCTCACTACCTTTTACCGACGGGCTGAGCTTGCGCGTCGGCTGGCCATCCTG
TCGGCGTCTGTGGGGGTGGCCAATGGGTTTAGTGGCTTGTTGGCCTTTGCGCTGTTTCGTGTCCCGGCTGGGCCG
TTGTTGTTCTCATGGCGATATCTGTTTCTCGTTGAGGGGGCTGCTTCGGTCGTGCTGGCAGTTGTGGCCTTTTTC
GTCTTGCCCAGGTCTGCTGCTGAGGCGAGCTTCCTGAACGAAACAGAGCGAGCTCTGGCCCTCCGTCGAATCCGT
CTCGACTCGTCGTCCGGAAACACCTCAGACCGACCCAGGAAGCTATCCGATGCCCTCAGCATCCTCACCCACCCG
ACATCGATAGCCTTTCTCGCCATCGAGATATGTGTGGGCGTACCTCTTCAGGCGGTAGCCCTCTTCATGCCGCAG
ATCATCCAGCGGCTGGGCTACTCGACCGTTCAGACCAACCTGTTGACCGTCGCGCCCAATGCTACCGGTTCCGTC
GCCCTGCTTCTACTGGCTTTCGCCTCGGATGCTTCGAGGTTGCGGTTTCCGTTGGTCGTCCTGGCTTTCTCGTTG
ACGCTTACGGGTTTCGTCGTCTACGCTGCCATCGGTGACGTCGGCAAGAGTCTCAGGCTGGCGTACGCTGCCACC
TTCATCATGTGTTGGGGATCCGTCGCGCCTTCAGTCCTCCTCTCAACCTGGTATAATAACAACGTTGCTGACGAT
GGACGCCGTCTTGTCCTGACGTCTGTTGGTGTCCCGCTCGCCAACCTCATGGGCCTCGTCTCAGCCAACGTCTTC
CGCGAGCGGGATGCGCCAAAGTATACGCCTGCCCTCATCACTACTGCCTGTTTCGGCGGTGCTGGCGCTCTGATA
TCTGCTTGTCTTGGTCTCTACATGGTGTTTGATAATAGGCGGCGCGATAGGAGGGATGGAGTGAGTCTGAGGGCG
CGCGATGTGCCGACTCAACGGCTTAGAGATGGACCCAGCGTGCGGGAATTCCGCTGGTTTCTCTAG
Gene >Ophun1|2988
ATGGCCAGCTCCCCAGCAAAAGACGAGCCCATCGTCGAAACAGACTCCCACGTCGTAGAGACAGACCCCCGCGTC
ACAGACCACGCCGCCGAGCGAAAACTCTGCTTCAAATTCGACCTCCGTATCCTCCCCGTCCTCGCCCTCCTCTGT
ATGTTGCCCCTCGATTGTCTCAATCTCTATCAAGCTTAATGATGTAGATCTCTGCAATGCTCTTGACAAGGGAAA
TCTTGGAAATGCGCAGACCGGCGGCCTCGGCAAAGGTTCACCACCTAGCCCCCATTCCCATCCCCATCCCCTTCA
CCACCACTAACACCCCAGACCAGACCTCAACTTCCAACCAGGCCAGTACAACACCATCATCTCAATCTTCTTCAT
TCCCTTCGTCCTCTTCGCACCCCCCTTCTCAATCCTAAGCCGCCGCTTCGGTCCTGCCAGAGCCCTCCCCGTCAT
GACGGCCCTCTTCGGCACCGTCACCCTCGTCACCGCCTCCGCCCGCTCCTTCGGCCCCGTCCTCGCCCTCCGATG
GCTCCTGGGAATGTCCGAGGCCGCTTTCTACCCCGTTGCCATCTACTACCTCACTACCTTTTACCGACGGGCTGA
GCTTGCGCGTCGGCTGGCCATCCTGTCGGCGTCTGTGGGGGTGGCCAATGGGTTTAGTGGCTTGTTGGCCTTTGC
GCTGTTTCGTGTCCCGGCTGGGCCGTTGTTGTTCTCATGGCGATATCTGTTTCTCGTTGAGGGGGCTGCTTCGGT
CGTGCTGGCAGTTGTGGCCTTTTTCGTCTTGCCCAGGTCTGCTGCTGAGGCGAGCTTCCTGAACGAAACAGAGCG
AGCTCTGGCCCTCCGTCGAATCCGTCTCGACTCGTCGTCCGGAAACACCTCAGACCGACCCAGGAAGCTATCCGA
TGCCCTCAGCATCCTCACCCACCCGACATCGATAGCCTTTCTCGCCATCGAGATATGTGTGGGCGTACCTCTTCA
GGCGGTAGCCCTCTTCATGCCGCAGATCATCCAGCGGCTGGGCTACTCGACCGTTCAGACCAACCTGTTGACCGT
CGCGCCCAATGCTACCGGTTCCGTCGCCCTGCTTCTACTGGCTTTCGCCTCGGATGCTTCGAGGTTGCGGTTTCC
GTTGGTCGTCCTGGCTTTCTCGTTGACGCTTACGGGTTTCGTCGTCTACGCTGCCATCGGTGACGTCGGCAAGAG
TCTCAGGCTGGCGTACGCTGCCACCTTCATCATGTGTTGGGGATCCGTCGCGCCTTCAGTCCTCCTCTCAACCTG
GTATAATAACAACGTTGCTGACGATGGACGCCGTCTTGTCCTGACGTCTGTTGGTGTCCCGCTCGCCAACCTCAT
GGGCCTCGTCTCAGCCAACGTCTTCCGCGAGCGGGATGCGCCAAAGTATACGCCTGCCCTCATCACTACTGCCTG
TTTCGGCGGTGCTGGCGCTCTGATATCTGCTTGTCTTGGTCTCTACATGGTGTTTGATAATAGGCGGCGCGATAG
GAGGGATGGAGTGAGTCTGAGGGCGCGCGATGTGCCGACTCAACGGCTTAGAGATGGACCCAGCGTGCGGGAATT
CCGCTGGTTTCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail