Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|298
Gene name
LocationContig_108:3776..6362
Strand-
Gene length (bp)2586
Transcript length (bp)2586
Coding sequence length (bp)2586
Protein length (aa) 862

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.7E-54 480 693

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 243 265 22
2 285 307 22
3 671 693 22
4 708 730 22
5 750 772 22
6 801 823 22
7 835 857 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT2_Glyco_trans_2_3 1.4E-55 480 693

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup220
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4835
Ophiocordyceps australis 1348a (Ghana) OphauG2|7233
Ophiocordyceps australis map64 (Brazil) OphauB2|1479
Ophiocordyceps australis map64 (Brazil) OphauB2|3624
Ophiocordyceps camponoti-floridani Ophcf2|00995
Ophiocordyceps camponoti-floridani Ophcf2|05069
Ophiocordyceps camponoti-rufipedis Ophun1|298 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5225
Ophiocordyceps kimflemingae Ophio5|3631
Ophiocordyceps subramaniannii Hirsu2|2492
Ophiocordyceps subramaniannii Hirsu2|3837

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|298
MGLGSYLTPNKAEPPPASPDKQPDMPPTDRLMPPTPRYQSRPSSSGRSTPSTRSSVFLDDIKHEVMVNYLYQQQC
SQLWVSDGSGEIEGVLLRKTRGCYMACPPQLGSSPFAMACAAMNLQCAMTVNSRVIKSFLQWSPDAVDVPLMGGL
RIQILPTLDDLARARKHQFAAFVASEGLLVVWDDDPLHLVQRARAIESELMELVWKAGPDAEADAGAEKRVETDE
ESGETRPETRPVHLQNSVLVSLTLALVVTSLGAAWRQLAIEVSVDGNYTRLALVALCPLQVFFSLFFAQVIVGCL
AQILGPIRQLSVNSKFFSARAPPRLRTAVLPHVTIQCPVYKEGLHAVIAPTVRSVKQAMSTYELQGGSANIFIND
DGLQLMNEADRSARIDFYADNNIGWVARPAHQKDGFQRKGKFKKASNMNYGLKISCAVEDRLQALDRPAEWSQHD
EALTYEEVLKDVLDEDGVAWADGNVRMGDYILLIDSDTRVPPDCLLDAVSEMEQSPDVAILQFSSGVMQVVHTYF
ENGIRFFTDLIYTAISYTVSSGDVAPFVGHNACLRWTAIQQVSYRDEDGYDKFWSESHVSEDFDMSLRLQTMGYV
IRLATWAGDGFKEGVSLTVYDELARWEKYAYGCNELLFNPIRTWLWRGPFTPLFRRFLWSNIRFTSKITVLSYIG
TYYAIGAAWIMTVVNYFLVGWFNGYLDKYYVDSWRVWFSIVIVFNGLGNVALAVMRYRAGERTLMGLFENFKWTL
MLAIFLGGLSLHISQALLAHMFEVDISWGATSKEAEFANFFTEIPKVLKKFSLSMLFSIVSVAVMVVLAVGPVPR
DWRIDDFTAILPLSTVVASHFLLPLALNPALMTFSF*
Coding >Ophun1|298
ATGGGCCTCGGATCCTACTTGACGCCAAACAAGGCCGAACCCCCTCCGGCCTCCCCGGACAAGCAGCCGGACATG
CCCCCCACCGACCGGCTCATGCCTCCGACCCCCCGCTACCAGTCCCGGCCCTCCAGCTCGGGCCGGAGCACGCCG
TCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTACCAGCAGCAGTGC
TCGCAGCTATGGGTGAGCGATGGCTCGGGCGAGATCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTATATG
GCCTGTCCGCCGCAGCTGGGCAGCTCGCCCTTTGCCATGGCCTGCGCGGCCATGAATCTTCAGTGCGCAATGACG
GTCAACTCTCGCGTCATAAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTGATGGGCGGTCTC
CGGATCCAGATATTGCCGACGCTCGATGACCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCATTTGTCGCTTCG
GAAGGCTTGCTGGTTGTCTGGGACGATGATCCGTTACATCTGGTGCAGCGGGCGAGAGCCATAGAGTCGGAGCTC
ATGGAACTAGTCTGGAAGGCCGGTCCGGACGCAGAGGCCGATGCCGGGGCCGAGAAGCGGGTCGAGACGGACGAG
GAGAGCGGCGAGACGCGGCCCGAGACGCGGCCCGTTCACCTGCAGAATTCGGTGCTCGTCAGTCTGACGCTCGCT
CTGGTTGTCACTTCGCTCGGCGCTGCTTGGAGACAGCTGGCCATCGAGGTCTCGGTTGATGGCAACTATACGCGT
CTCGCACTCGTGGCCCTCTGTCCGCTGCAGGTCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGCTGTCTG
GCTCAGATACTCGGTCCTATTCGGCAGCTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGGCTCCGCCTCGGCTT
CGGACTGCGGTGCTGCCGCATGTGACGATCCAGTGTCCCGTCTATAAGGAGGGTCTACACGCTGTCATTGCACCG
ACTGTTAGGTCGGTCAAGCAGGCCATGTCGACGTATGAGCTTCAGGGCGGGTCGGCCAACATCTTCATCAACGAC
GATGGGCTGCAGCTCATGAACGAGGCGGATCGTTCGGCTCGGATCGACTTTTACGCTGATAATAACATTGGCTGG
GTTGCGCGTCCGGCTCATCAGAAGGACGGCTTCCAGCGGAAGGGCAAGTTCAAGAAGGCCTCCAACATGAACTAC
GGTCTCAAGATCTCGTGTGCCGTCGAGGACCGGCTGCAGGCGCTGGACCGTCCGGCTGAATGGTCACAGCACGAT
GAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTACTGGACGAGGATGGAGTGGCATGGGCAGATGGAAATGTG
AGGATGGGCGACTATATCCTCCTCATCGACAGCGACACTCGTGTACCGCCAGACTGCCTCCTTGATGCCGTCTCC
GAGATGGAACAGTCGCCAGACGTGGCCATCTTGCAGTTCTCATCGGGCGTTATGCAAGTCGTCCACACCTACTTT
GAGAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGCGACGTGGCT
CCCTTTGTCGGCCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGCTAC
GACAAGTTCTGGTCTGAGAGCCACGTGTCTGAGGATTTCGACATGTCTCTTCGTCTGCAAACCATGGGATACGTC
ATCCGATTGGCAACTTGGGCTGGCGACGGCTTCAAAGAGGGCGTCTCGCTTACCGTGTACGATGAGCTGGCCCGT
TGGGAAAAGTACGCCTACGGCTGCAATGAGCTGCTCTTCAACCCGATCCGCACCTGGCTCTGGCGTGGACCCTTT
ACGCCTCTCTTCCGACGCTTCCTATGGTCTAATATCCGCTTCACCTCCAAGATCACCGTCCTCTCCTACATAGGC
ACCTACTACGCCATCGGTGCGGCCTGGATCATGACCGTCGTCAACTACTTTCTCGTCGGCTGGTTCAACGGCTAT
CTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAACGTC
GCCCTCGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACTCTC
ATGCTGGCCATCTTCCTCGGCGGCCTCTCTCTGCACATCAGCCAAGCCCTTCTTGCCCACATGTTCGAGGTCGAC
ATCAGCTGGGGCGCCACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTCAAGAAG
TTCTCCTTGTCGATGCTCTTCTCCATCGTGTCCGTCGCCGTCATGGTTGTGCTGGCCGTCGGGCCTGTGCCGCGG
GACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTTTCGACTGTTGTGGCGAGTCATTTTTTGCTGCCGTTG
GCTTTGAATCCGGCCCTCATGACGTTTTCTTTTTGA
Transcript >Ophun1|298
ATGGGCCTCGGATCCTACTTGACGCCAAACAAGGCCGAACCCCCTCCGGCCTCCCCGGACAAGCAGCCGGACATG
CCCCCCACCGACCGGCTCATGCCTCCGACCCCCCGCTACCAGTCCCGGCCCTCCAGCTCGGGCCGGAGCACGCCG
TCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTACCAGCAGCAGTGC
TCGCAGCTATGGGTGAGCGATGGCTCGGGCGAGATCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTATATG
GCCTGTCCGCCGCAGCTGGGCAGCTCGCCCTTTGCCATGGCCTGCGCGGCCATGAATCTTCAGTGCGCAATGACG
GTCAACTCTCGCGTCATAAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTGATGGGCGGTCTC
CGGATCCAGATATTGCCGACGCTCGATGACCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCATTTGTCGCTTCG
GAAGGCTTGCTGGTTGTCTGGGACGATGATCCGTTACATCTGGTGCAGCGGGCGAGAGCCATAGAGTCGGAGCTC
ATGGAACTAGTCTGGAAGGCCGGTCCGGACGCAGAGGCCGATGCCGGGGCCGAGAAGCGGGTCGAGACGGACGAG
GAGAGCGGCGAGACGCGGCCCGAGACGCGGCCCGTTCACCTGCAGAATTCGGTGCTCGTCAGTCTGACGCTCGCT
CTGGTTGTCACTTCGCTCGGCGCTGCTTGGAGACAGCTGGCCATCGAGGTCTCGGTTGATGGCAACTATACGCGT
CTCGCACTCGTGGCCCTCTGTCCGCTGCAGGTCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGCTGTCTG
GCTCAGATACTCGGTCCTATTCGGCAGCTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGGCTCCGCCTCGGCTT
CGGACTGCGGTGCTGCCGCATGTGACGATCCAGTGTCCCGTCTATAAGGAGGGTCTACACGCTGTCATTGCACCG
ACTGTTAGGTCGGTCAAGCAGGCCATGTCGACGTATGAGCTTCAGGGCGGGTCGGCCAACATCTTCATCAACGAC
GATGGGCTGCAGCTCATGAACGAGGCGGATCGTTCGGCTCGGATCGACTTTTACGCTGATAATAACATTGGCTGG
GTTGCGCGTCCGGCTCATCAGAAGGACGGCTTCCAGCGGAAGGGCAAGTTCAAGAAGGCCTCCAACATGAACTAC
GGTCTCAAGATCTCGTGTGCCGTCGAGGACCGGCTGCAGGCGCTGGACCGTCCGGCTGAATGGTCACAGCACGAT
GAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTACTGGACGAGGATGGAGTGGCATGGGCAGATGGAAATGTG
AGGATGGGCGACTATATCCTCCTCATCGACAGCGACACTCGTGTACCGCCAGACTGCCTCCTTGATGCCGTCTCC
GAGATGGAACAGTCGCCAGACGTGGCCATCTTGCAGTTCTCATCGGGCGTTATGCAAGTCGTCCACACCTACTTT
GAGAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGCGACGTGGCT
CCCTTTGTCGGCCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGCTAC
GACAAGTTCTGGTCTGAGAGCCACGTGTCTGAGGATTTCGACATGTCTCTTCGTCTGCAAACCATGGGATACGTC
ATCCGATTGGCAACTTGGGCTGGCGACGGCTTCAAAGAGGGCGTCTCGCTTACCGTGTACGATGAGCTGGCCCGT
TGGGAAAAGTACGCCTACGGCTGCAATGAGCTGCTCTTCAACCCGATCCGCACCTGGCTCTGGCGTGGACCCTTT
ACGCCTCTCTTCCGACGCTTCCTATGGTCTAATATCCGCTTCACCTCCAAGATCACCGTCCTCTCCTACATAGGC
ACCTACTACGCCATCGGTGCGGCCTGGATCATGACCGTCGTCAACTACTTTCTCGTCGGCTGGTTCAACGGCTAT
CTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAACGTC
GCCCTCGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACTCTC
ATGCTGGCCATCTTCCTCGGCGGCCTCTCTCTGCACATCAGCCAAGCCCTTCTTGCCCACATGTTCGAGGTCGAC
ATCAGCTGGGGCGCCACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTCAAGAAG
TTCTCCTTGTCGATGCTCTTCTCCATCGTGTCCGTCGCCGTCATGGTTGTGCTGGCCGTCGGGCCTGTGCCGCGG
GACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTTTCGACTGTTGTGGCGAGTCATTTTTTGCTGCCGTTG
GCTTTGAATCCGGCCCTCATGACGTTTTCTTTTTGA
Gene >Ophun1|298
ATGGGCCTCGGATCCTACTTGACGCCAAACAAGGCCGAACCCCCTCCGGCCTCCCCGGACAAGCAGCCGGACATG
CCCCCCACCGACCGGCTCATGCCTCCGACCCCCCGCTACCAGTCCCGGCCCTCCAGCTCGGGCCGGAGCACGCCG
TCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTACCAGCAGCAGTGC
TCGCAGCTATGGGTGAGCGATGGCTCGGGCGAGATCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTATATG
GCCTGTCCGCCGCAGCTGGGCAGCTCGCCCTTTGCCATGGCCTGCGCGGCCATGAATCTTCAGTGCGCAATGACG
GTCAACTCTCGCGTCATAAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTGATGGGCGGTCTC
CGGATCCAGATATTGCCGACGCTCGATGACCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCATTTGTCGCTTCG
GAAGGCTTGCTGGTTGTCTGGGACGATGATCCGTTACATCTGGTGCAGCGGGCGAGAGCCATAGAGTCGGAGCTC
ATGGAACTAGTCTGGAAGGCCGGTCCGGACGCAGAGGCCGATGCCGGGGCCGAGAAGCGGGTCGAGACGGACGAG
GAGAGCGGCGAGACGCGGCCCGAGACGCGGCCCGTTCACCTGCAGAATTCGGTGCTCGTCAGTCTGACGCTCGCT
CTGGTTGTCACTTCGCTCGGCGCTGCTTGGAGACAGCTGGCCATCGAGGTCTCGGTTGATGGCAACTATACGCGT
CTCGCACTCGTGGCCCTCTGTCCGCTGCAGGTCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGCTGTCTG
GCTCAGATACTCGGTCCTATTCGGCAGCTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGGCTCCGCCTCGGCTT
CGGACTGCGGTGCTGCCGCATGTGACGATCCAGTGTCCCGTCTATAAGGAGGGTCTACACGCTGTCATTGCACCG
ACTGTTAGGTCGGTCAAGCAGGCCATGTCGACGTATGAGCTTCAGGGCGGGTCGGCCAACATCTTCATCAACGAC
GATGGGCTGCAGCTCATGAACGAGGCGGATCGTTCGGCTCGGATCGACTTTTACGCTGATAATAACATTGGCTGG
GTTGCGCGTCCGGCTCATCAGAAGGACGGCTTCCAGCGGAAGGGCAAGTTCAAGAAGGCCTCCAACATGAACTAC
GGTCTCAAGATCTCGTGTGCCGTCGAGGACCGGCTGCAGGCGCTGGACCGTCCGGCTGAATGGTCACAGCACGAT
GAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTACTGGACGAGGATGGAGTGGCATGGGCAGATGGAAATGTG
AGGATGGGCGACTATATCCTCCTCATCGACAGCGACACTCGTGTACCGCCAGACTGCCTCCTTGATGCCGTCTCC
GAGATGGAACAGTCGCCAGACGTGGCCATCTTGCAGTTCTCATCGGGCGTTATGCAAGTCGTCCACACCTACTTT
GAGAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGCGACGTGGCT
CCCTTTGTCGGCCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGCTAC
GACAAGTTCTGGTCTGAGAGCCACGTGTCTGAGGATTTCGACATGTCTCTTCGTCTGCAAACCATGGGATACGTC
ATCCGATTGGCAACTTGGGCTGGCGACGGCTTCAAAGAGGGCGTCTCGCTTACCGTGTACGATGAGCTGGCCCGT
TGGGAAAAGTACGCCTACGGCTGCAATGAGCTGCTCTTCAACCCGATCCGCACCTGGCTCTGGCGTGGACCCTTT
ACGCCTCTCTTCCGACGCTTCCTATGGTCTAATATCCGCTTCACCTCCAAGATCACCGTCCTCTCCTACATAGGC
ACCTACTACGCCATCGGTGCGGCCTGGATCATGACCGTCGTCAACTACTTTCTCGTCGGCTGGTTCAACGGCTAT
CTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAACGTC
GCCCTCGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACTCTC
ATGCTGGCCATCTTCCTCGGCGGCCTCTCTCTGCACATCAGCCAAGCCCTTCTTGCCCACATGTTCGAGGTCGAC
ATCAGCTGGGGCGCCACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTCAAGAAG
TTCTCCTTGTCGATGCTCTTCTCCATCGTGTCCGTCGCCGTCATGGTTGTGCTGGCCGTCGGGCCTGTGCCGCGG
GACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTTTCGACTGTTGTGGCGAGTCATTTTTTGCTGCCGTTG
GCTTTGAATCCGGCCCTCATGACGTTTTCTTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail