Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|298
Gene name
LocationContig_108:3776..6362
Strand-
Gene length (bp)2586
Transcript length (bp)2586
Coding sequence length (bp)2586
Protein length (aa) 862

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.7E-54 480 693

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 243 265 22
2 285 307 22
3 671 693 22
4 708 730 22
5 750 772 22
6 801 823 22
7 835 857 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|298
MGLGSYLTPNKAEPPPASPDKQPDMPPTDRLMPPTPRYQSRPSSSGRSTPSTRSSVFLDDIKHEVMVNYLYQQQC
SQLWVSDGSGEIEGVLLRKTRGCYMACPPQLGSSPFAMACAAMNLQCAMTVNSRVIKSFLQWSPDAVDVPLMGGL
RIQILPTLDDLARARKHQFAAFVASEGLLVVWDDDPLHLVQRARAIESELMELVWKAGPDAEADAGAEKRVETDE
ESGETRPETRPVHLQNSVLVSLTLALVVTSLGAAWRQLAIEVSVDGNYTRLALVALCPLQVFFSLFFAQVIVGCL
AQILGPIRQLSVNSKFFSARAPPRLRTAVLPHVTIQCPVYKEGLHAVIAPTVRSVKQAMSTYELQGGSANIFIND
DGLQLMNEADRSARIDFYADNNIGWVARPAHQKDGFQRKGKFKKASNMNYGLKISCAVEDRLQALDRPAEWSQHD
EALTYEEVLKDVLDEDGVAWADGNVRMGDYILLIDSDTRVPPDCLLDAVSEMEQSPDVAILQFSSGVMQVVHTYF
ENGIRFFTDLIYTAISYTVSSGDVAPFVGHNACLRWTAIQQVSYRDEDGYDKFWSESHVSEDFDMSLRLQTMGYV
IRLATWAGDGFKEGVSLTVYDELARWEKYAYGCNELLFNPIRTWLWRGPFTPLFRRFLWSNIRFTSKITVLSYIG
TYYAIGAAWIMTVVNYFLVGWFNGYLDKYYVDSWRVWFSIVIVFNGLGNVALAVMRYRAGERTLMGLFENFKWTL
MLAIFLGGLSLHISQALLAHMFEVDISWGATSKEAEFANFFTEIPKVLKKFSLSMLFSIVSVAVMVVLAVGPVPR
DWRIDDFTAILPLSTVVASHFLLPLALNPALMTFSF*
Coding >Ophun1|298
ATGGGCCTCGGATCCTACTTGACGCCAAACAAGGCCGAACCCCCTCCGGCCTCCCCGGACAAGCAGCCGGACATG
CCCCCCACCGACCGGCTCATGCCTCCGACCCCCCGCTACCAGTCCCGGCCCTCCAGCTCGGGCCGGAGCACGCCG
TCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTACCAGCAGCAGTGC
TCGCAGCTATGGGTGAGCGATGGCTCGGGCGAGATCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTATATG
GCCTGTCCGCCGCAGCTGGGCAGCTCGCCCTTTGCCATGGCCTGCGCGGCCATGAATCTTCAGTGCGCAATGACG
GTCAACTCTCGCGTCATAAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTGATGGGCGGTCTC
CGGATCCAGATATTGCCGACGCTCGATGACCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCATTTGTCGCTTCG
GAAGGCTTGCTGGTTGTCTGGGACGATGATCCGTTACATCTGGTGCAGCGGGCGAGAGCCATAGAGTCGGAGCTC
ATGGAACTAGTCTGGAAGGCCGGTCCGGACGCAGAGGCCGATGCCGGGGCCGAGAAGCGGGTCGAGACGGACGAG
GAGAGCGGCGAGACGCGGCCCGAGACGCGGCCCGTTCACCTGCAGAATTCGGTGCTCGTCAGTCTGACGCTCGCT
CTGGTTGTCACTTCGCTCGGCGCTGCTTGGAGACAGCTGGCCATCGAGGTCTCGGTTGATGGCAACTATACGCGT
CTCGCACTCGTGGCCCTCTGTCCGCTGCAGGTCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGCTGTCTG
GCTCAGATACTCGGTCCTATTCGGCAGCTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGGCTCCGCCTCGGCTT
CGGACTGCGGTGCTGCCGCATGTGACGATCCAGTGTCCCGTCTATAAGGAGGGTCTACACGCTGTCATTGCACCG
ACTGTTAGGTCGGTCAAGCAGGCCATGTCGACGTATGAGCTTCAGGGCGGGTCGGCCAACATCTTCATCAACGAC
GATGGGCTGCAGCTCATGAACGAGGCGGATCGTTCGGCTCGGATCGACTTTTACGCTGATAATAACATTGGCTGG
GTTGCGCGTCCGGCTCATCAGAAGGACGGCTTCCAGCGGAAGGGCAAGTTCAAGAAGGCCTCCAACATGAACTAC
GGTCTCAAGATCTCGTGTGCCGTCGAGGACCGGCTGCAGGCGCTGGACCGTCCGGCTGAATGGTCACAGCACGAT
GAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTACTGGACGAGGATGGAGTGGCATGGGCAGATGGAAATGTG
AGGATGGGCGACTATATCCTCCTCATCGACAGCGACACTCGTGTACCGCCAGACTGCCTCCTTGATGCCGTCTCC
GAGATGGAACAGTCGCCAGACGTGGCCATCTTGCAGTTCTCATCGGGCGTTATGCAAGTCGTCCACACCTACTTT
GAGAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGCGACGTGGCT
CCCTTTGTCGGCCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGCTAC
GACAAGTTCTGGTCTGAGAGCCACGTGTCTGAGGATTTCGACATGTCTCTTCGTCTGCAAACCATGGGATACGTC
ATCCGATTGGCAACTTGGGCTGGCGACGGCTTCAAAGAGGGCGTCTCGCTTACCGTGTACGATGAGCTGGCCCGT
TGGGAAAAGTACGCCTACGGCTGCAATGAGCTGCTCTTCAACCCGATCCGCACCTGGCTCTGGCGTGGACCCTTT
ACGCCTCTCTTCCGACGCTTCCTATGGTCTAATATCCGCTTCACCTCCAAGATCACCGTCCTCTCCTACATAGGC
ACCTACTACGCCATCGGTGCGGCCTGGATCATGACCGTCGTCAACTACTTTCTCGTCGGCTGGTTCAACGGCTAT
CTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAACGTC
GCCCTCGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACTCTC
ATGCTGGCCATCTTCCTCGGCGGCCTCTCTCTGCACATCAGCCAAGCCCTTCTTGCCCACATGTTCGAGGTCGAC
ATCAGCTGGGGCGCCACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTCAAGAAG
TTCTCCTTGTCGATGCTCTTCTCCATCGTGTCCGTCGCCGTCATGGTTGTGCTGGCCGTCGGGCCTGTGCCGCGG
GACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTTTCGACTGTTGTGGCGAGTCATTTTTTGCTGCCGTTG
GCTTTGAATCCGGCCCTCATGACGTTTTCTTTTTGA
Transcript >Ophun1|298
ATGGGCCTCGGATCCTACTTGACGCCAAACAAGGCCGAACCCCCTCCGGCCTCCCCGGACAAGCAGCCGGACATG
CCCCCCACCGACCGGCTCATGCCTCCGACCCCCCGCTACCAGTCCCGGCCCTCCAGCTCGGGCCGGAGCACGCCG
TCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTACCAGCAGCAGTGC
TCGCAGCTATGGGTGAGCGATGGCTCGGGCGAGATCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTATATG
GCCTGTCCGCCGCAGCTGGGCAGCTCGCCCTTTGCCATGGCCTGCGCGGCCATGAATCTTCAGTGCGCAATGACG
GTCAACTCTCGCGTCATAAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTGATGGGCGGTCTC
CGGATCCAGATATTGCCGACGCTCGATGACCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCATTTGTCGCTTCG
GAAGGCTTGCTGGTTGTCTGGGACGATGATCCGTTACATCTGGTGCAGCGGGCGAGAGCCATAGAGTCGGAGCTC
ATGGAACTAGTCTGGAAGGCCGGTCCGGACGCAGAGGCCGATGCCGGGGCCGAGAAGCGGGTCGAGACGGACGAG
GAGAGCGGCGAGACGCGGCCCGAGACGCGGCCCGTTCACCTGCAGAATTCGGTGCTCGTCAGTCTGACGCTCGCT
CTGGTTGTCACTTCGCTCGGCGCTGCTTGGAGACAGCTGGCCATCGAGGTCTCGGTTGATGGCAACTATACGCGT
CTCGCACTCGTGGCCCTCTGTCCGCTGCAGGTCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGCTGTCTG
GCTCAGATACTCGGTCCTATTCGGCAGCTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGGCTCCGCCTCGGCTT
CGGACTGCGGTGCTGCCGCATGTGACGATCCAGTGTCCCGTCTATAAGGAGGGTCTACACGCTGTCATTGCACCG
ACTGTTAGGTCGGTCAAGCAGGCCATGTCGACGTATGAGCTTCAGGGCGGGTCGGCCAACATCTTCATCAACGAC
GATGGGCTGCAGCTCATGAACGAGGCGGATCGTTCGGCTCGGATCGACTTTTACGCTGATAATAACATTGGCTGG
GTTGCGCGTCCGGCTCATCAGAAGGACGGCTTCCAGCGGAAGGGCAAGTTCAAGAAGGCCTCCAACATGAACTAC
GGTCTCAAGATCTCGTGTGCCGTCGAGGACCGGCTGCAGGCGCTGGACCGTCCGGCTGAATGGTCACAGCACGAT
GAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTACTGGACGAGGATGGAGTGGCATGGGCAGATGGAAATGTG
AGGATGGGCGACTATATCCTCCTCATCGACAGCGACACTCGTGTACCGCCAGACTGCCTCCTTGATGCCGTCTCC
GAGATGGAACAGTCGCCAGACGTGGCCATCTTGCAGTTCTCATCGGGCGTTATGCAAGTCGTCCACACCTACTTT
GAGAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGCGACGTGGCT
CCCTTTGTCGGCCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGCTAC
GACAAGTTCTGGTCTGAGAGCCACGTGTCTGAGGATTTCGACATGTCTCTTCGTCTGCAAACCATGGGATACGTC
ATCCGATTGGCAACTTGGGCTGGCGACGGCTTCAAAGAGGGCGTCTCGCTTACCGTGTACGATGAGCTGGCCCGT
TGGGAAAAGTACGCCTACGGCTGCAATGAGCTGCTCTTCAACCCGATCCGCACCTGGCTCTGGCGTGGACCCTTT
ACGCCTCTCTTCCGACGCTTCCTATGGTCTAATATCCGCTTCACCTCCAAGATCACCGTCCTCTCCTACATAGGC
ACCTACTACGCCATCGGTGCGGCCTGGATCATGACCGTCGTCAACTACTTTCTCGTCGGCTGGTTCAACGGCTAT
CTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAACGTC
GCCCTCGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACTCTC
ATGCTGGCCATCTTCCTCGGCGGCCTCTCTCTGCACATCAGCCAAGCCCTTCTTGCCCACATGTTCGAGGTCGAC
ATCAGCTGGGGCGCCACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTCAAGAAG
TTCTCCTTGTCGATGCTCTTCTCCATCGTGTCCGTCGCCGTCATGGTTGTGCTGGCCGTCGGGCCTGTGCCGCGG
GACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTTTCGACTGTTGTGGCGAGTCATTTTTTGCTGCCGTTG
GCTTTGAATCCGGCCCTCATGACGTTTTCTTTTTGA
Gene >Ophun1|298
ATGGGCCTCGGATCCTACTTGACGCCAAACAAGGCCGAACCCCCTCCGGCCTCCCCGGACAAGCAGCCGGACATG
CCCCCCACCGACCGGCTCATGCCTCCGACCCCCCGCTACCAGTCCCGGCCCTCCAGCTCGGGCCGGAGCACGCCG
TCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTACCAGCAGCAGTGC
TCGCAGCTATGGGTGAGCGATGGCTCGGGCGAGATCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTATATG
GCCTGTCCGCCGCAGCTGGGCAGCTCGCCCTTTGCCATGGCCTGCGCGGCCATGAATCTTCAGTGCGCAATGACG
GTCAACTCTCGCGTCATAAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTGATGGGCGGTCTC
CGGATCCAGATATTGCCGACGCTCGATGACCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCATTTGTCGCTTCG
GAAGGCTTGCTGGTTGTCTGGGACGATGATCCGTTACATCTGGTGCAGCGGGCGAGAGCCATAGAGTCGGAGCTC
ATGGAACTAGTCTGGAAGGCCGGTCCGGACGCAGAGGCCGATGCCGGGGCCGAGAAGCGGGTCGAGACGGACGAG
GAGAGCGGCGAGACGCGGCCCGAGACGCGGCCCGTTCACCTGCAGAATTCGGTGCTCGTCAGTCTGACGCTCGCT
CTGGTTGTCACTTCGCTCGGCGCTGCTTGGAGACAGCTGGCCATCGAGGTCTCGGTTGATGGCAACTATACGCGT
CTCGCACTCGTGGCCCTCTGTCCGCTGCAGGTCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGCTGTCTG
GCTCAGATACTCGGTCCTATTCGGCAGCTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGGCTCCGCCTCGGCTT
CGGACTGCGGTGCTGCCGCATGTGACGATCCAGTGTCCCGTCTATAAGGAGGGTCTACACGCTGTCATTGCACCG
ACTGTTAGGTCGGTCAAGCAGGCCATGTCGACGTATGAGCTTCAGGGCGGGTCGGCCAACATCTTCATCAACGAC
GATGGGCTGCAGCTCATGAACGAGGCGGATCGTTCGGCTCGGATCGACTTTTACGCTGATAATAACATTGGCTGG
GTTGCGCGTCCGGCTCATCAGAAGGACGGCTTCCAGCGGAAGGGCAAGTTCAAGAAGGCCTCCAACATGAACTAC
GGTCTCAAGATCTCGTGTGCCGTCGAGGACCGGCTGCAGGCGCTGGACCGTCCGGCTGAATGGTCACAGCACGAT
GAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTACTGGACGAGGATGGAGTGGCATGGGCAGATGGAAATGTG
AGGATGGGCGACTATATCCTCCTCATCGACAGCGACACTCGTGTACCGCCAGACTGCCTCCTTGATGCCGTCTCC
GAGATGGAACAGTCGCCAGACGTGGCCATCTTGCAGTTCTCATCGGGCGTTATGCAAGTCGTCCACACCTACTTT
GAGAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGCGACGTGGCT
CCCTTTGTCGGCCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGCTAC
GACAAGTTCTGGTCTGAGAGCCACGTGTCTGAGGATTTCGACATGTCTCTTCGTCTGCAAACCATGGGATACGTC
ATCCGATTGGCAACTTGGGCTGGCGACGGCTTCAAAGAGGGCGTCTCGCTTACCGTGTACGATGAGCTGGCCCGT
TGGGAAAAGTACGCCTACGGCTGCAATGAGCTGCTCTTCAACCCGATCCGCACCTGGCTCTGGCGTGGACCCTTT
ACGCCTCTCTTCCGACGCTTCCTATGGTCTAATATCCGCTTCACCTCCAAGATCACCGTCCTCTCCTACATAGGC
ACCTACTACGCCATCGGTGCGGCCTGGATCATGACCGTCGTCAACTACTTTCTCGTCGGCTGGTTCAACGGCTAT
CTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAACGTC
GCCCTCGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACTCTC
ATGCTGGCCATCTTCCTCGGCGGCCTCTCTCTGCACATCAGCCAAGCCCTTCTTGCCCACATGTTCGAGGTCGAC
ATCAGCTGGGGCGCCACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTCAAGAAG
TTCTCCTTGTCGATGCTCTTCTCCATCGTGTCCGTCGCCGTCATGGTTGTGCTGGCCGTCGGGCCTGTGCCGCGG
GACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTTTCGACTGTTGTGGCGAGTCATTTTTTGCTGCCGTTG
GCTTTGAATCCGGCCCTCATGACGTTTTCTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail