Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2978
Gene name
LocationContig_265:3989..5120
Strand-
Gene length (bp)1131
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 3.4E-63 34 373

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 19 376 3.0E-64
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 15 376 3.0E-54
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 1 376 5.0E-53
sp|O81123|ZIP1_ARATH Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1 24 376 1.0E-29
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 8 376 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 19 376 3.0E-64
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 15 376 3.0E-54
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 1 376 5.0E-53
sp|O81123|ZIP1_ARATH Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1 24 376 1.0E-29
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 8 376 1.0E-28
sp|Q8S3W4|ZIP8_ARATH Probable zinc transporter 8 OS=Arabidopsis thaliana GN=ZIP8 PE=2 SV=1 16 376 2.0E-27
sp|Q8W245|ZIP10_ARATH Probable zinc transporter 10 OS=Arabidopsis thaliana GN=ZIP10 PE=1 SV=2 9 376 2.0E-26
sp|Q38856|IRT1_ARATH Fe(2+) transport protein 1 OS=Arabidopsis thaliana GN=IRT1 PE=1 SV=2 3 376 3.0E-26
sp|Q75HB1|IRT1_ORYSJ Fe(2+) transport protein 1 OS=Oryza sativa subsp. japonica GN=IRT1 PE=2 SV=1 11 376 4.0E-26
sp|O81850|IRT2_ARATH Fe(2+) transport protein 2 OS=Arabidopsis thaliana GN=IRT2 PE=1 SV=1 14 376 5.0E-25
sp|O23039|ZIP5_ARATH Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1 15 376 6.0E-25
sp|Q8W246|ZIP7_ARATH Zinc transporter 7 OS=Arabidopsis thaliana GN=ZIP7 PE=2 SV=1 23 376 8.0E-25
sp|Q6L8G0|ZIP5_ORYSJ Zinc transporter 5 OS=Oryza sativa subsp. japonica GN=ZIP5 PE=2 SV=1 35 376 5.0E-24
sp|Q0DHE3|ZIP9_ORYSJ Zinc transporter 9 OS=Oryza sativa subsp. japonica GN=ZIP9 PE=3 SV=3 19 376 9.0E-22
sp|Q7XLD4|ZIP3_ORYSJ Zinc transporter 3 OS=Oryza sativa subsp. japonica GN=ZIP3 PE=1 SV=2 16 376 9.0E-22
sp|Q6L8G1|IRT2_ORYSJ Fe(2+) transport protein 2 OS=Oryza sativa subsp. japonica GN=IRT2 PE=2 SV=1 23 376 3.0E-21
sp|Q9FIS2|ZIP12_ARATH Probable zinc transporter 12 OS=Arabidopsis thaliana GN=ZIP12 PE=3 SV=1 36 376 3.0E-21
sp|O04089|ZIP4_ARATH Zinc transporter 4, chloroplastic OS=Arabidopsis thaliana GN=ZIP4 PE=2 SV=1 44 376 6.0E-20
sp|Q6L8F7|ZIP7_ORYSJ Zinc transporter 7 OS=Oryza sativa subsp. japonica GN=ZIP7 PE=2 SV=1 11 376 2.0E-17
sp|O64738|ZIP6_ARATH Zinc transporter 6, chloroplastic OS=Arabidopsis thaliana GN=ZIP6 PE=3 SV=1 13 376 6.0E-17
sp|O82643|ZIP9_ARATH Zinc transporter 9 OS=Arabidopsis thaliana GN=ZIP9 PE=2 SV=1 63 376 6.0E-17
sp|Q6L8F9|ZIP6_ORYSJ Zinc transporter 6 OS=Oryza sativa subsp. japonica GN=ZIP6 PE=2 SV=1 35 376 4.0E-15
sp|Q8LE59|IRT3_ARATH Fe(2+) transport protein 3, chloroplastic OS=Arabidopsis thaliana GN=IRT3 PE=2 SV=3 225 376 6.0E-15
sp|Q5Z653|ZIP10_ORYSJ Zinc transporter 10 OS=Oryza sativa subsp. japonica GN=ZIP10 PE=3 SV=2 225 342 1.0E-13
sp|Q6ZJ91|ZIP4_ORYSJ Zinc transporter 4 OS=Oryza sativa subsp. japonica GN=ZIP4 PE=2 SV=1 32 376 7.0E-12
sp|Q6QQT1|S39A1_TAKRU Zinc transporter ZIP1 OS=Takifugu rubripes GN=slc39a1 PE=2 SV=1 233 341 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0006810 transport No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 69 91 22
3 111 133 22
4 220 242 22
5 252 274 22
6 281 303 22
7 318 337 19
8 356 373 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2978
MSLVLRPRSHGQGPDESTSAEHCHDEPVQLGRTSLRVGAIFILLVLAFAAAVAPIVLSRRTRMRGNKAVFFVFKY
VGTGVILATAWMHLLAPAIEQLGDGCVGHDWPAMAGYPWALCIALMTVMAMFLFELIVSGVGDSSQVVQDGRLAV
NSAGSDSDATNPPSSNNHLAAFKRSVDGEEDEDVEKTDARAGTQAPAVETWQPTQSPGSRATKGGLAGQLTAVLI
LEFGVVFHSVFIGLTLGTTADDDLVILLVVLVVHQMFEGLGLGARLAVAPWPQGKGWVPWILALGFALSTPIGVA
AALGAKPADASTQKLVNGIFDAISAGILMYTALVELLAHEMLLDPVMRRASLGRKLAAYGCVAVGVFVMALLAKW
A*
Coding >Ophun1|2978
ATGTCGCTCGTCCTGCGGCCCAGGTCCCACGGCCAAGGCCCCGACGAATCGACGTCAGCCGAGCATTGCCATGAC
GAGCCCGTCCAGCTGGGCAGGACGTCTCTGCGCGTCGGGGCCATCTTTATACTGCTGGTGCTGGCCTTTGCTGCC
GCCGTGGCGCCTATAGTCTTGTCGCGCCGCACTCGGATGCGCGGGAACAAGGCCGTCTTCTTCGTCTTCAAGTAT
GTCGGAACCGGCGTCATCCTCGCCACTGCTTGGATGCATTTACTTGCTCCGGCCATCGAGCAGCTGGGCGATGGC
TGCGTCGGACATGATTGGCCTGCCATGGCTGGGTATCCGTGGGCGCTTTGCATCGCCTTGATGACCGTCATGGCC
ATGTTTCTATTCGAGTTGATCGTCTCGGGCGTGGGCGATTCTTCCCAAGTCGTTCAAGATGGCCGCCTTGCCGTG
AACAGCGCCGGCTCCGACTCGGACGCGACGAATCCCCCCTCGTCCAACAATCATCTCGCCGCCTTCAAGAGGTCC
GTCGACGGCGAAGAAGATGAAGACGTTGAAAAGACGGATGCCCGAGCCGGAACACAAGCTCCGGCCGTCGAGACG
TGGCAGCCGACGCAAAGCCCCGGATCGAGAGCCACCAAGGGCGGACTGGCGGGCCAACTAACGGCCGTGCTGATT
CTCGAATTCGGCGTCGTCTTCCACAGCGTCTTCATCGGCCTCACGCTCGGCACCACGGCAGACGACGACCTCGTC
ATCCTCCTCGTCGTCCTCGTCGTCCACCAAATGTTCGAGGGCCTCGGTCTGGGCGCCAGACTGGCCGTCGCCCCC
TGGCCTCAGGGCAAGGGCTGGGTTCCGTGGATACTGGCCCTCGGATTCGCCTTATCGACGCCGATTGGCGTGGCG
GCCGCTCTGGGCGCCAAGCCGGCCGACGCGTCGACGCAGAAGCTCGTCAACGGCATCTTTGACGCCATCAGCGCG
GGCATCCTCATGTACACTGCTCTTGTCGAGCTGCTGGCGCACGAGATGTTGCTGGATCCGGTTATGCGTCGTGCC
TCGTTGGGCCGGAAGCTGGCTGCTTACGGCTGTGTCGCTGTCGGTGTCTTTGTCATGGCTCTGTTGGCAAAGTGG
GCGTAA
Transcript >Ophun1|2978
ATGTCGCTCGTCCTGCGGCCCAGGTCCCACGGCCAAGGCCCCGACGAATCGACGTCAGCCGAGCATTGCCATGAC
GAGCCCGTCCAGCTGGGCAGGACGTCTCTGCGCGTCGGGGCCATCTTTATACTGCTGGTGCTGGCCTTTGCTGCC
GCCGTGGCGCCTATAGTCTTGTCGCGCCGCACTCGGATGCGCGGGAACAAGGCCGTCTTCTTCGTCTTCAAGTAT
GTCGGAACCGGCGTCATCCTCGCCACTGCTTGGATGCATTTACTTGCTCCGGCCATCGAGCAGCTGGGCGATGGC
TGCGTCGGACATGATTGGCCTGCCATGGCTGGGTATCCGTGGGCGCTTTGCATCGCCTTGATGACCGTCATGGCC
ATGTTTCTATTCGAGTTGATCGTCTCGGGCGTGGGCGATTCTTCCCAAGTCGTTCAAGATGGCCGCCTTGCCGTG
AACAGCGCCGGCTCCGACTCGGACGCGACGAATCCCCCCTCGTCCAACAATCATCTCGCCGCCTTCAAGAGGTCC
GTCGACGGCGAAGAAGATGAAGACGTTGAAAAGACGGATGCCCGAGCCGGAACACAAGCTCCGGCCGTCGAGACG
TGGCAGCCGACGCAAAGCCCCGGATCGAGAGCCACCAAGGGCGGACTGGCGGGCCAACTAACGGCCGTGCTGATT
CTCGAATTCGGCGTCGTCTTCCACAGCGTCTTCATCGGCCTCACGCTCGGCACCACGGCAGACGACGACCTCGTC
ATCCTCCTCGTCGTCCTCGTCGTCCACCAAATGTTCGAGGGCCTCGGTCTGGGCGCCAGACTGGCCGTCGCCCCC
TGGCCTCAGGGCAAGGGCTGGGTTCCGTGGATACTGGCCCTCGGATTCGCCTTATCGACGCCGATTGGCGTGGCG
GCCGCTCTGGGCGCCAAGCCGGCCGACGCGTCGACGCAGAAGCTCGTCAACGGCATCTTTGACGCCATCAGCGCG
GGCATCCTCATGTACACTGCTCTTGTCGAGCTGCTGGCGCACGAGATGTTGCTGGATCCGGTTATGCGTCGTGCC
TCGTTGGGCCGGAAGCTGGCTGCTTACGGCTGTGTCGCTGTCGGTGTCTTTGTCATGGCTCTGTTGGCAAAGTGG
GCGTAA
Gene >Ophun1|2978
ATGTCGCTCGTCCTGCGGCCCAGGTCCCACGGCCAAGGCCCCGACGAATCGACGTCAGCCGAGCATTGCCATGAC
GAGCCCGTCCAGCTGGGCAGGACGTCTCTGCGCGTCGGGGCCATCTTTATACTGCTGGTGCTGGCCTTTGCTGCC
GCCGTGGCGCCTATAGTCTTGTCGCGCCGCACTCGGATGCGCGGGAACAAGGCCGTCTTCTTCGTCTTCAAGTAT
GTCGGAACCGGCGTCATCCTCGCCACTGCTTGGATGCATTTACTTGCTCCGGCCATCGAGCAGCTGGGCGATGGC
TGCGTCGGACATGATTGGCCTGCCATGGCTGGGTATCCGTGGGCGCTTTGCATCGCCTTGATGACCGTCATGGCC
ATGTTTCTATTCGAGTTGATCGTCTCGGGCGTGGGCGATTCTTCCCAAGTCGTTCAAGATGGCCGCCTTGCCGTG
AACAGCGCCGGCTCCGACTCGGACGCGACGAATCCCCCCTCGTCCAACAATCATCTCGCCGCCTTCAAGAGGTCC
GTCGACGGCGAAGAAGATGAAGACGTTGAAAAGACGGATGCCCGAGCCGGAACACAAGCTCCGGCCGTCGAGACG
TGGCAGCCGACGCAAAGCCCCGGATCGAGAGCCACCAAGGGCGGACTGGCGGGCCAACTAACGGCCGTGCTGATT
CTCGAATTCGGCGTCGTCTTCCACAGCGTCTTCATCGGCCTCACGCTCGGCACCACGGCAGACGACGACCTCGTC
ATCCTCCTCGTCGTCCTCGTCGTCCACCAAATGTTCGAGGGCCTCGGTCTGGGCGCCAGACTGGCCGTCGCCCCC
TGGCCTCAGGGCAAGGGCTGGGTTCCGTGGATACTGGCCCTCGGATTCGCCTTATCGACGCCGATTGGCGTGGCG
GCCGCTCTGGGCGCCAAGCCGGCCGACGCGTCGACGCAGAAGCTCGTCAACGGCATCTTTGACGCCATCAGCGCG
GGCATCCTCATGTACACTGCTCTTGTCGAGCTGCTGGCGCACGAGATGTTGCTGGATCCGGTTATGCGTCGTGCC
TCGTTGGGCCGGAAGCTGGCTGCTTACGGCTGTGTCGCTGTCGGTGTCTTTGTCATGGCTCTGTTGGCAAAGTGG
GCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail