Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2972
Gene name
LocationContig_264:12377..16024
Strand+
Gene length (bp)3647
Transcript length (bp)3567
Coding sequence length (bp)3567
Protein length (aa) 1189

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01841 Transglut_core Transglutaminase-like superfamily 2.4E-09 721 819
PF07653 SH3_2 Variant SH3 domain 4.8E-06 15 70

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14302|CYK3_SCHPO cytokinesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyk3 PE=1 SV=1 591 1187 1.0E-77
sp|Q07533|CYK3_YEAST Cytokinesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYK3 PE=1 SV=1 463 1187 2.0E-60
sp|O14302|CYK3_SCHPO cytokinesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyk3 PE=1 SV=1 8 71 2.0E-16
sp|Q8NBH2|KY_HUMAN Kyphoscoliosis peptidase OS=Homo sapiens GN=KY PE=1 SV=2 680 870 7.0E-12
sp|Q8C8H8|KY_MOUSE Kyphoscoliosis peptidase OS=Mus musculus GN=Ky PE=1 SV=1 723 870 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14302|CYK3_SCHPO cytokinesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyk3 PE=1 SV=1 591 1187 1.0E-77
sp|Q07533|CYK3_YEAST Cytokinesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYK3 PE=1 SV=1 463 1187 2.0E-60
sp|O14302|CYK3_SCHPO cytokinesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyk3 PE=1 SV=1 8 71 2.0E-16
sp|Q8NBH2|KY_HUMAN Kyphoscoliosis peptidase OS=Homo sapiens GN=KY PE=1 SV=2 680 870 7.0E-12
sp|Q8C8H8|KY_MOUSE Kyphoscoliosis peptidase OS=Mus musculus GN=Ky PE=1 SV=1 723 870 2.0E-11
sp|Q07533|CYK3_YEAST Cytokinesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYK3 PE=1 SV=1 13 81 4.0E-09
sp|Q62420|SH3G2_MOUSE Endophilin-A1 OS=Mus musculus GN=Sh3gl2 PE=1 SV=2 3 71 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3051
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5222
Ophiocordyceps australis map64 (Brazil) OphauB2|3596
Ophiocordyceps camponoti-floridani Ophcf2|00619
Ophiocordyceps camponoti-rufipedis Ophun1|2972 (this protein)
Ophiocordyceps kimflemingae Ophio5|3111
Ophiocordyceps subramaniannii Hirsu2|5286

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2972
MVPAPPMLPAQFPCWCRAIYSWGGESKRDLGFIEGDLIECLNAGDGSWWVGRLYRDRRTVGSFPSNFVEVLPDGF
RPATRSVSPMPDRASSSPKAMTSKSKTFRKPFEAYAKAPHYTSAKQPETFREPPRPRTREEHTPRSVHDGIDNVP
SPPPGRGYGSRAPSPMPSPSPSPVPSMRYESRTPIDDGASPPPPPPPPHRHIRQNGSQDMLPGGYNPVARHGSTA
SYNHYRHGSDDSYQAPHHLSRHPSHVGYSDAPHDVRPCTPRAPSPRPPSPAGSHMTPSPLREAMDGVMEQLGQLG
GFRERCSQEPLSPEEAPVDPWSPESFDLATPRSRRPPTEHARPVTSMGIAHHDEGYETWSGESSRGASHHGGHRE
VNRLNSYVQRMESQLQRGHAASFDASVGDMGPPPPPPPKGQPYDRPKTSSGEAVVLERESLRTRKSAYEVGRGVG
RTYTTKTNVTNASSGNQSNASASTQSSGRTLWSGTSASAFSATSAGSFSRTHARAQSALGMREFDMDRPGTPFTG
VTYHSSHASNAGEVRPASQAAVHDDLGAGLGGLVQPKAPKRNIFRKMFDSAKTGVASNRISISAAGSGSSPFSRQ
NSSPVSSKTRTMAETAQRDTSGVDWVQVRRDVNRSNSLSKIERDERRDRCQMMDYPALNPVDELLDSIEGDEGAD
GMPVRSPLNYQAINFAQVDKNSRFIAEPPPMTTAATLATAYVCRPYRSEVQRLRAIFTWVAERICWEQEAEGAAD
SRRVIETKRACAEEYAALVLDLCAAAGLECEMVRGFLKSPGDVLDTTMAPRSNHWWNAVVVDGEWRMMDCCLASP
SNPKRGLYSSVSGASADFWWFLARPSELCWTHVPEHHDQQHMVPPVAHEVLLNLPCACPALFRHGIELVDFNTAA
TRIEDLEMVHIKLNVPADVEVAAEVEARALCRDSDGDVFESGDRIRKRALAQAEWTGGVKRYVVKALLPGDEGHG
TLNIYAGKRGLMQSIKDIPHPLALSLPVVHLGENPPYEFVTRHPTPHAQRHDIYVVQPQCQRLALNNTFVFAIRQ
HPSTPAAGCGPLTPASNPGATSPVPYARPSSAMSMAASSSVSNPSSSATGTVAGKKPAKLAIQTPGGKILRLMRK
EERRGVGGRPATAGGTGVDGEDATDGGTWETIIKCSERGLWRGLVLADRTARWCVFAEWVCVG*
Coding >Ophun1|2972
ATGGTTCCCGCTCCGCCGATGCTTCCGGCTCAGTTCCCCTGCTGGTGCCGGGCCATTTATTCCTGGGGAGGCGAG
TCCAAGCGTGACCTCGGCTTCATTGAAGGCGACCTCATCGAGTGTCTAAACGCTGGCGATGGGTCCTGGTGGGTT
GGCCGACTCTATCGCGATCGAAGGACTGTCGGCTCGTTCCCGTCAAACTTCGTCGAGGTCCTCCCCGACGGATTT
CGTCCAGCAACCAGGTCCGTCAGCCCAATGCCGGATCGAGCCTCGTCCAGCCCCAAAGCCATGACGTCCAAATCC
AAAACGTTTCGCAAGCCCTTCGAGGCCTACGCCAAAGCGCCGCATTATACCAGCGCCAAGCAGCCAGAGACCTTT
CGGGAGCCTCCCAGACCGCGGACCAGGGAAGAGCATACCCCCAGAAGTGTTCACGACGGCATCGACAATGTGCCG
TCTCCCCCTCCAGGCCGTGGTTACGGATCACGAGCGCCGTCGCCCATGCCGTCGCCATCGCCGTCTCCCGTACCG
TCCATGAGATACGAATCTCGGACTCCGATCGACGACGGGGCCTCTCCTCCTCCGCCTCCACCGCCACCACATCGT
CATATCCGCCAGAACGGGTCCCAAGACATGCTTCCTGGGGGCTACAACCCCGTAGCCCGGCACGGCTCGACAGCT
TCGTACAATCATTACCGCCACGGGTCTGACGACTCGTATCAAGCACCGCACCATCTGTCGAGACATCCGTCGCAC
GTCGGATACTCCGATGCGCCTCACGACGTCCGCCCTTGCACTCCCCGAGCTCCGTCTCCGAGGCCGCCATCACCT
GCGGGCAGCCACATGACGCCGTCGCCGCTGCGAGAGGCGATGGACGGCGTCATGGAGCAGCTGGGCCAACTAGGC
GGCTTTAGAGAAAGATGCAGCCAAGAACCGTTATCCCCGGAAGAAGCGCCCGTGGATCCCTGGTCTCCCGAGTCG
TTCGACTTGGCGACGCCGCGATCTAGACGCCCGCCGACCGAGCACGCGAGACCGGTGACGTCGATGGGCATCGCT
CATCACGACGAAGGATACGAGACCTGGAGTGGCGAGTCCAGTCGGGGAGCCTCGCACCACGGCGGACATCGTGAG
GTCAATCGTCTGAACAGCTATGTGCAGAGGATGGAGAGTCAGCTTCAGCGAGGTCACGCTGCCAGCTTCGACGCG
TCCGTGGGAGACATGGGCCCCCCTCCGCCTCCTCCGCCCAAAGGTCAGCCATACGATAGGCCCAAGACGTCGTCC
GGCGAGGCCGTCGTGCTGGAAAGGGAGTCTCTGCGGACTCGCAAGTCTGCCTATGAGGTAGGTCGCGGCGTCGGC
AGGACTTACACGACCAAGACCAACGTCACCAATGCCTCATCCGGCAACCAGAGCAACGCCAGCGCCTCGACGCAG
AGCAGCGGCCGGACGCTATGGAGCGGCACGTCGGCCAGCGCTTTCAGTGCTACCAGCGCCGGGAGCTTCTCGCGG
ACGCATGCCCGTGCCCAGAGTGCGCTGGGGATGCGCGAGTTCGACATGGACCGGCCTGGGACGCCCTTCACCGGC
GTCACCTACCACAGTAGCCATGCCAGTAACGCGGGCGAAGTCCGTCCGGCCTCACAGGCGGCCGTCCACGACGAT
CTCGGGGCTGGACTCGGTGGTCTCGTCCAGCCCAAGGCACCGAAGCGCAACATCTTTCGCAAAATGTTCGACTCG
GCCAAGACGGGCGTCGCCAGTAACCGCATCAGCATCTCGGCCGCCGGATCTGGCTCATCGCCCTTTTCCCGGCAG
AATTCGTCGCCCGTGTCGAGTAAGACGAGGACGATGGCCGAGACGGCGCAGAGAGACACGAGCGGCGTCGACTGG
GTACAGGTGCGTCGCGACGTCAACCGATCCAACTCGCTCAGTAAGATTGAGCGGGACGAGAGGAGAGATCGGTGC
CAGATGATGGACTATCCGGCCCTCAATCCCGTCGACGAGCTGCTAGACAGCATCGAGGGCGATGAGGGCGCCGAC
GGGATGCCCGTGAGGTCTCCTCTGAACTACCAAGCCATCAACTTCGCCCAGGTGGATAAGAACTCGCGCTTCATC
GCCGAGCCGCCGCCCATGACGACAGCGGCGACGCTGGCCACGGCGTACGTCTGCCGGCCCTATCGGAGCGAGGTG
CAGCGGCTGCGGGCCATCTTCACCTGGGTGGCCGAGCGCATCTGCTGGGAGCAAGAGGCCGAGGGCGCGGCCGAC
AGCAGGCGCGTCATCGAGACGAAGCGGGCGTGCGCCGAGGAGTACGCGGCCCTCGTGCTGGATCTTTGCGCAGCG
GCTGGGCTCGAGTGCGAGATGGTACGAGGCTTCCTCAAGAGCCCTGGCGACGTGCTGGATACGACCATGGCGCCT
CGGTCCAACCACTGGTGGAATGCTGTCGTCGTCGACGGGGAGTGGCGCATGATGGACTGCTGCTTGGCCAGCCCA
TCGAACCCGAAGCGAGGCCTGTACTCGAGCGTCAGTGGCGCCTCGGCCGACTTCTGGTGGTTCTTGGCCCGGCCG
TCAGAGCTGTGTTGGACGCACGTGCCCGAGCATCACGACCAGCAGCACATGGTGCCTCCCGTCGCGCACGAGGTG
CTACTCAACCTGCCGTGCGCCTGCCCGGCCCTGTTCCGGCACGGCATCGAGCTGGTCGACTTCAACACGGCCGCG
ACGCGCATCGAGGACCTCGAAATGGTGCATATCAAGCTCAACGTGCCAGCCGACGTCGAGGTGGCGGCCGAGGTC
GAGGCTCGCGCCCTGTGTCGGGACTCGGACGGCGACGTCTTCGAGAGCGGCGATCGGATCCGCAAGCGGGCGCTG
GCCCAGGCAGAGTGGACGGGCGGCGTCAAGCGATACGTCGTCAAGGCCCTGCTTCCGGGGGACGAGGGCCACGGC
ACGCTCAACATTTATGCTGGCAAGCGAGGGTTGATGCAAAGCATCAAAGACATCCCGCATCCGCTGGCGCTGTCG
CTTCCCGTCGTCCATTTGGGCGAGAACCCGCCGTATGAGTTCGTCACGCGGCATCCGACTCCGCACGCGCAGCGC
CACGATATCTACGTGGTGCAGCCTCAATGCCAGCGGCTGGCGCTCAACAACACCTTCGTCTTCGCCATACGCCAG
CATCCGAGCACGCCGGCGGCCGGGTGCGGACCTCTGACTCCGGCTTCGAACCCGGGCGCGACGAGCCCCGTACCG
TACGCGCGGCCGTCGTCGGCCATGAGCATGGCCGCCTCGTCCAGCGTCTCCAACCCAAGCTCATCGGCCACCGGC
ACCGTCGCCGGTAAGAAGCCGGCGAAGCTTGCCATCCAGACGCCCGGCGGCAAGATCCTTCGCTTGATGAGAAAG
GAGGAGCGACGTGGCGTCGGCGGAAGGCCAGCAACGGCGGGAGGAACTGGTGTCGACGGCGAAGATGCAACCGAT
GGCGGCACGTGGGAGACCATCATCAAGTGCTCCGAGAGGGGACTCTGGCGCGGCTTGGTGCTGGCAGACCGAACA
GCGCGATGGTGTGTCTTTGCCGAATGGGTCTGTGTCGGTTAA
Transcript >Ophun1|2972
ATGGTTCCCGCTCCGCCGATGCTTCCGGCTCAGTTCCCCTGCTGGTGCCGGGCCATTTATTCCTGGGGAGGCGAG
TCCAAGCGTGACCTCGGCTTCATTGAAGGCGACCTCATCGAGTGTCTAAACGCTGGCGATGGGTCCTGGTGGGTT
GGCCGACTCTATCGCGATCGAAGGACTGTCGGCTCGTTCCCGTCAAACTTCGTCGAGGTCCTCCCCGACGGATTT
CGTCCAGCAACCAGGTCCGTCAGCCCAATGCCGGATCGAGCCTCGTCCAGCCCCAAAGCCATGACGTCCAAATCC
AAAACGTTTCGCAAGCCCTTCGAGGCCTACGCCAAAGCGCCGCATTATACCAGCGCCAAGCAGCCAGAGACCTTT
CGGGAGCCTCCCAGACCGCGGACCAGGGAAGAGCATACCCCCAGAAGTGTTCACGACGGCATCGACAATGTGCCG
TCTCCCCCTCCAGGCCGTGGTTACGGATCACGAGCGCCGTCGCCCATGCCGTCGCCATCGCCGTCTCCCGTACCG
TCCATGAGATACGAATCTCGGACTCCGATCGACGACGGGGCCTCTCCTCCTCCGCCTCCACCGCCACCACATCGT
CATATCCGCCAGAACGGGTCCCAAGACATGCTTCCTGGGGGCTACAACCCCGTAGCCCGGCACGGCTCGACAGCT
TCGTACAATCATTACCGCCACGGGTCTGACGACTCGTATCAAGCACCGCACCATCTGTCGAGACATCCGTCGCAC
GTCGGATACTCCGATGCGCCTCACGACGTCCGCCCTTGCACTCCCCGAGCTCCGTCTCCGAGGCCGCCATCACCT
GCGGGCAGCCACATGACGCCGTCGCCGCTGCGAGAGGCGATGGACGGCGTCATGGAGCAGCTGGGCCAACTAGGC
GGCTTTAGAGAAAGATGCAGCCAAGAACCGTTATCCCCGGAAGAAGCGCCCGTGGATCCCTGGTCTCCCGAGTCG
TTCGACTTGGCGACGCCGCGATCTAGACGCCCGCCGACCGAGCACGCGAGACCGGTGACGTCGATGGGCATCGCT
CATCACGACGAAGGATACGAGACCTGGAGTGGCGAGTCCAGTCGGGGAGCCTCGCACCACGGCGGACATCGTGAG
GTCAATCGTCTGAACAGCTATGTGCAGAGGATGGAGAGTCAGCTTCAGCGAGGTCACGCTGCCAGCTTCGACGCG
TCCGTGGGAGACATGGGCCCCCCTCCGCCTCCTCCGCCCAAAGGTCAGCCATACGATAGGCCCAAGACGTCGTCC
GGCGAGGCCGTCGTGCTGGAAAGGGAGTCTCTGCGGACTCGCAAGTCTGCCTATGAGGTAGGTCGCGGCGTCGGC
AGGACTTACACGACCAAGACCAACGTCACCAATGCCTCATCCGGCAACCAGAGCAACGCCAGCGCCTCGACGCAG
AGCAGCGGCCGGACGCTATGGAGCGGCACGTCGGCCAGCGCTTTCAGTGCTACCAGCGCCGGGAGCTTCTCGCGG
ACGCATGCCCGTGCCCAGAGTGCGCTGGGGATGCGCGAGTTCGACATGGACCGGCCTGGGACGCCCTTCACCGGC
GTCACCTACCACAGTAGCCATGCCAGTAACGCGGGCGAAGTCCGTCCGGCCTCACAGGCGGCCGTCCACGACGAT
CTCGGGGCTGGACTCGGTGGTCTCGTCCAGCCCAAGGCACCGAAGCGCAACATCTTTCGCAAAATGTTCGACTCG
GCCAAGACGGGCGTCGCCAGTAACCGCATCAGCATCTCGGCCGCCGGATCTGGCTCATCGCCCTTTTCCCGGCAG
AATTCGTCGCCCGTGTCGAGTAAGACGAGGACGATGGCCGAGACGGCGCAGAGAGACACGAGCGGCGTCGACTGG
GTACAGGTGCGTCGCGACGTCAACCGATCCAACTCGCTCAGTAAGATTGAGCGGGACGAGAGGAGAGATCGGTGC
CAGATGATGGACTATCCGGCCCTCAATCCCGTCGACGAGCTGCTAGACAGCATCGAGGGCGATGAGGGCGCCGAC
GGGATGCCCGTGAGGTCTCCTCTGAACTACCAAGCCATCAACTTCGCCCAGGTGGATAAGAACTCGCGCTTCATC
GCCGAGCCGCCGCCCATGACGACAGCGGCGACGCTGGCCACGGCGTACGTCTGCCGGCCCTATCGGAGCGAGGTG
CAGCGGCTGCGGGCCATCTTCACCTGGGTGGCCGAGCGCATCTGCTGGGAGCAAGAGGCCGAGGGCGCGGCCGAC
AGCAGGCGCGTCATCGAGACGAAGCGGGCGTGCGCCGAGGAGTACGCGGCCCTCGTGCTGGATCTTTGCGCAGCG
GCTGGGCTCGAGTGCGAGATGGTACGAGGCTTCCTCAAGAGCCCTGGCGACGTGCTGGATACGACCATGGCGCCT
CGGTCCAACCACTGGTGGAATGCTGTCGTCGTCGACGGGGAGTGGCGCATGATGGACTGCTGCTTGGCCAGCCCA
TCGAACCCGAAGCGAGGCCTGTACTCGAGCGTCAGTGGCGCCTCGGCCGACTTCTGGTGGTTCTTGGCCCGGCCG
TCAGAGCTGTGTTGGACGCACGTGCCCGAGCATCACGACCAGCAGCACATGGTGCCTCCCGTCGCGCACGAGGTG
CTACTCAACCTGCCGTGCGCCTGCCCGGCCCTGTTCCGGCACGGCATCGAGCTGGTCGACTTCAACACGGCCGCG
ACGCGCATCGAGGACCTCGAAATGGTGCATATCAAGCTCAACGTGCCAGCCGACGTCGAGGTGGCGGCCGAGGTC
GAGGCTCGCGCCCTGTGTCGGGACTCGGACGGCGACGTCTTCGAGAGCGGCGATCGGATCCGCAAGCGGGCGCTG
GCCCAGGCAGAGTGGACGGGCGGCGTCAAGCGATACGTCGTCAAGGCCCTGCTTCCGGGGGACGAGGGCCACGGC
ACGCTCAACATTTATGCTGGCAAGCGAGGGTTGATGCAAAGCATCAAAGACATCCCGCATCCGCTGGCGCTGTCG
CTTCCCGTCGTCCATTTGGGCGAGAACCCGCCGTATGAGTTCGTCACGCGGCATCCGACTCCGCACGCGCAGCGC
CACGATATCTACGTGGTGCAGCCTCAATGCCAGCGGCTGGCGCTCAACAACACCTTCGTCTTCGCCATACGCCAG
CATCCGAGCACGCCGGCGGCCGGGTGCGGACCTCTGACTCCGGCTTCGAACCCGGGCGCGACGAGCCCCGTACCG
TACGCGCGGCCGTCGTCGGCCATGAGCATGGCCGCCTCGTCCAGCGTCTCCAACCCAAGCTCATCGGCCACCGGC
ACCGTCGCCGGTAAGAAGCCGGCGAAGCTTGCCATCCAGACGCCCGGCGGCAAGATCCTTCGCTTGATGAGAAAG
GAGGAGCGACGTGGCGTCGGCGGAAGGCCAGCAACGGCGGGAGGAACTGGTGTCGACGGCGAAGATGCAACCGAT
GGCGGCACGTGGGAGACCATCATCAAGTGCTCCGAGAGGGGACTCTGGCGCGGCTTGGTGCTGGCAGACCGAACA
GCGCGATGGTGTGTCTTTGCCGAATGGGTCTGTGTCGGTTAA
Gene >Ophun1|2972
ATGGTTCCCGCTCCGCCGATGCTTCCGGCTCAGTTCCCCTGCTGGTGCCGGGCCATTTATTCCTGGGGAGGCGAG
GTCGGTGTCTATTTCTTCTTCTGCTTCCCCTCCTCATCATCCTCCTTTCGTCCCTGTTCGCTAATCGAAAAAGAA
AACAGTCCAAGCGTGACCTCGGCTTCATTGAAGGCGACCTCATCGAGTGTCTAAACGCTGGCGATGGGTCCTGGT
GGGTTGGCCGACTCTATCGCGATCGAAGGACTGTCGGCTCGTTCCCGTCAAACTTCGTCGAGGTCCTCCCCGACG
GATTTCGTCCAGCAACCAGGTCCGTCAGCCCAATGCCGGATCGAGCCTCGTCCAGCCCCAAAGCCATGACGTCCA
AATCCAAAACGTTTCGCAAGCCCTTCGAGGCCTACGCCAAAGCGCCGCATTATACCAGCGCCAAGCAGCCAGAGA
CCTTTCGGGAGCCTCCCAGACCGCGGACCAGGGAAGAGCATACCCCCAGAAGTGTTCACGACGGCATCGACAATG
TGCCGTCTCCCCCTCCAGGCCGTGGTTACGGATCACGAGCGCCGTCGCCCATGCCGTCGCCATCGCCGTCTCCCG
TACCGTCCATGAGATACGAATCTCGGACTCCGATCGACGACGGGGCCTCTCCTCCTCCGCCTCCACCGCCACCAC
ATCGTCATATCCGCCAGAACGGGTCCCAAGACATGCTTCCTGGGGGCTACAACCCCGTAGCCCGGCACGGCTCGA
CAGCTTCGTACAATCATTACCGCCACGGGTCTGACGACTCGTATCAAGCACCGCACCATCTGTCGAGACATCCGT
CGCACGTCGGATACTCCGATGCGCCTCACGACGTCCGCCCTTGCACTCCCCGAGCTCCGTCTCCGAGGCCGCCAT
CACCTGCGGGCAGCCACATGACGCCGTCGCCGCTGCGAGAGGCGATGGACGGCGTCATGGAGCAGCTGGGCCAAC
TAGGCGGCTTTAGAGAAAGATGCAGCCAAGAACCGTTATCCCCGGAAGAAGCGCCCGTGGATCCCTGGTCTCCCG
AGTCGTTCGACTTGGCGACGCCGCGATCTAGACGCCCGCCGACCGAGCACGCGAGACCGGTGACGTCGATGGGCA
TCGCTCATCACGACGAAGGATACGAGACCTGGAGTGGCGAGTCCAGTCGGGGAGCCTCGCACCACGGCGGACATC
GTGAGGTCAATCGTCTGAACAGCTATGTGCAGAGGATGGAGAGTCAGCTTCAGCGAGGTCACGCTGCCAGCTTCG
ACGCGTCCGTGGGAGACATGGGCCCCCCTCCGCCTCCTCCGCCCAAAGGTCAGCCATACGATAGGCCCAAGACGT
CGTCCGGCGAGGCCGTCGTGCTGGAAAGGGAGTCTCTGCGGACTCGCAAGTCTGCCTATGAGGTAGGTCGCGGCG
TCGGCAGGACTTACACGACCAAGACCAACGTCACCAATGCCTCATCCGGCAACCAGAGCAACGCCAGCGCCTCGA
CGCAGAGCAGCGGCCGGACGCTATGGAGCGGCACGTCGGCCAGCGCTTTCAGTGCTACCAGCGCCGGGAGCTTCT
CGCGGACGCATGCCCGTGCCCAGAGTGCGCTGGGGATGCGCGAGTTCGACATGGACCGGCCTGGGACGCCCTTCA
CCGGCGTCACCTACCACAGTAGCCATGCCAGTAACGCGGGCGAAGTCCGTCCGGCCTCACAGGCGGCCGTCCACG
ACGATCTCGGGGCTGGACTCGGTGGTCTCGTCCAGCCCAAGGCACCGAAGCGCAACATCTTTCGCAAAATGTTCG
ACTCGGCCAAGACGGGCGTCGCCAGTAACCGCATCAGCATCTCGGCCGCCGGATCTGGCTCATCGCCCTTTTCCC
GGCAGAATTCGTCGCCCGTGTCGAGTAAGACGAGGACGATGGCCGAGACGGCGCAGAGAGACACGAGCGGCGTCG
ACTGGGTACAGGTGCGTCGCGACGTCAACCGATCCAACTCGCTCAGTAAGATTGAGCGGGACGAGAGGAGAGATC
GGTGCCAGATGATGGACTATCCGGCCCTCAATCCCGTCGACGAGCTGCTAGACAGCATCGAGGGCGATGAGGGCG
CCGACGGGATGCCCGTGAGGTCTCCTCTGAACTACCAAGCCATCAACTTCGCCCAGGTGGATAAGAACTCGCGCT
TCATCGCCGAGCCGCCGCCCATGACGACAGCGGCGACGCTGGCCACGGCGTACGTCTGCCGGCCCTATCGGAGCG
AGGTGCAGCGGCTGCGGGCCATCTTCACCTGGGTGGCCGAGCGCATCTGCTGGGAGCAAGAGGCCGAGGGCGCGG
CCGACAGCAGGCGCGTCATCGAGACGAAGCGGGCGTGCGCCGAGGAGTACGCGGCCCTCGTGCTGGATCTTTGCG
CAGCGGCTGGGCTCGAGTGCGAGATGGTACGAGGCTTCCTCAAGAGCCCTGGCGACGTGCTGGATACGACCATGG
CGCCTCGGTCCAACCACTGGTGGAATGCTGTCGTCGTCGACGGGGAGTGGCGCATGATGGACTGCTGCTTGGCCA
GCCCATCGAACCCGAAGCGAGGCCTGTACTCGAGCGTCAGTGGCGCCTCGGCCGACTTCTGGTGGTTCTTGGCCC
GGCCGTCAGAGCTGTGTTGGACGCACGTGCCCGAGCATCACGACCAGCAGCACATGGTGCCTCCCGTCGCGCACG
AGGTGCTACTCAACCTGCCGTGCGCCTGCCCGGCCCTGTTCCGGCACGGCATCGAGCTGGTCGACTTCAACACGG
CCGCGACGCGCATCGAGGACCTCGAAATGGTGCATATCAAGCTCAACGTGCCAGCCGACGTCGAGGTGGCGGCCG
AGGTCGAGGCTCGCGCCCTGTGTCGGGACTCGGACGGCGACGTCTTCGAGAGCGGCGATCGGATCCGCAAGCGGG
CGCTGGCCCAGGCAGAGTGGACGGGCGGCGTCAAGCGATACGTCGTCAAGGCCCTGCTTCCGGGGGACGAGGGCC
ACGGCACGCTCAACATTTATGCTGGCAAGCGAGGGTTGATGCAAAGCATCAAAGACATCCCGCATCCGCTGGCGC
TGTCGCTTCCCGTCGTCCATTTGGGCGAGAACCCGCCGTATGAGTTCGTCACGCGGCATCCGACTCCGCACGCGC
AGCGCCACGATATCTACGTGGTGCAGCCTCAATGCCAGCGGCTGGCGCTCAACAACACCTTCGTCTTCGCCATAC
GCCAGCATCCGAGCACGCCGGCGGCCGGGTGCGGACCTCTGACTCCGGCTTCGAACCCGGGCGCGACGAGCCCCG
TACCGTACGCGCGGCCGTCGTCGGCCATGAGCATGGCCGCCTCGTCCAGCGTCTCCAACCCAAGCTCATCGGCCA
CCGGCACCGTCGCCGGTAAGAAGCCGGCGAAGCTTGCCATCCAGACGCCCGGCGGCAAGATCCTTCGCTTGATGA
GAAAGGAGGAGCGACGTGGCGTCGGCGGAAGGCCAGCAACGGCGGGAGGAACTGGTGTCGACGGCGAAGATGCAA
CCGATGGCGGCACGTGGGAGACCATCATCAAGTGCTCCGAGAGGGGACTCTGGCGCGGCTTGGTGCTGGCAGACC
GAACAGCGCGATGGTGTGTCTTTGCCGAATGGGTCTGTGTCGGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail