Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2963
Gene name
LocationContig_263:8493..10131
Strand-
Gene length (bp)1638
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 8.5E-21 69 214

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 2 524 6.0E-39
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 1 526 1.0E-36
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 64 253 1.0E-06

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2963
MPLAVSCYPGPDQDIERCSYVNSMWSNETFQTGQPMGRYYPYNIACPPVYVDTASEQPRCSIGQLPVYSVNVTEH
QDISQALTFAQRHNIRMTIVNTGHDLNGRSDGFGSLAIWIRNLRRGLHFQYQFSSATGCSRSGWSGSAIHIDGAW
TWREVHRVARRNNVIVVGGGSDSPGATGGWLSGGGHGPASRNYGLGADQLLEAHVMLASGRVVIANHCQHRLLFR
ALRGGGPGYGIVLGTKVKAYPNVDKVTAHRLNVSSVRSDSDLLDAVALLLQSHARLVDSGFAGYATWFRSMPVAV
MGNSSSGYTHSMWTIGMSKADADAALSLLRKKLARIGHKLLIDESWAEYRDYWSFYDAELGRDGPPGDSIVVTSR
LLRRDSVQNYRRVRDAVEIVSGKAGEGTFNIVGLVSGGKILDDEVDKTSGLNPAWHSSPLLLITARPVSKTASSV
ERQAVMDDITTVKGAATKRLAQDTGGYMNEGDRNDAHYIQEFYGRAYKGHLEAKTVYDPSGVFYCPTCVGAEAFI
DNPHGPLCSAEPLPQTEARA*
Coding >Ophun1|2963
ATGCCCTTGGCCGTCTCATGCTACCCTGGCCCCGACCAAGACATCGAGCGATGCTCTTACGTGAACAGCATGTGG
TCAAACGAGACCTTCCAGACAGGCCAGCCAATGGGCCGTTACTATCCCTACAACATCGCCTGTCCTCCGGTGTAT
GTCGATACAGCATCGGAGCAGCCGAGATGCTCGATAGGGCAGCTTCCGGTCTACAGCGTCAACGTGACAGAACAC
CAAGACATTTCTCAGGCGCTCACCTTTGCGCAGCGGCACAACATCCGGATGACCATCGTCAACACGGGCCACGAC
CTCAACGGCCGGTCCGACGGCTTCGGAAGCCTGGCCATCTGGATCCGCAACCTTCGACGCGGCCTCCACTTCCAG
TATCAATTTTCGTCGGCTACCGGCTGCTCTCGCTCTGGCTGGTCCGGAAGCGCCATCCACATCGACGGCGCCTGG
ACGTGGCGAGAAGTACACCGAGTGGCCCGGCGGAACAATGTCATCGTCGTCGGCGGCGGCTCTGATTCCCCTGGA
GCCACCGGCGGCTGGCTCTCCGGGGGCGGACACGGACCGGCGTCGCGCAATTATGGCCTCGGCGCCGACCAGCTG
CTCGAAGCCCACGTTATGCTTGCAAGCGGACGCGTCGTCATCGCAAACCACTGCCAGCATCGGCTCCTGTTCCGT
GCCCTGCGAGGAGGCGGTCCGGGATACGGAATCGTCCTCGGCACAAAGGTCAAGGCGTATCCCAACGTAGACAAA
GTGACGGCTCACAGGCTCAACGTCTCATCCGTAAGATCCGATTCTGATCTGCTCGATGCCGTAGCCCTTCTGCTG
CAGTCTCATGCGAGACTTGTCGACTCTGGATTCGCTGGATATGCTACTTGGTTCCGTAGCATGCCCGTTGCTGTC
ATGGGCAACTCGTCATCTGGCTACACGCACAGCATGTGGACCATCGGCATGAGCAAGGCTGATGCCGACGCGGCC
CTGAGTCTTTTACGGAAGAAGCTGGCAAGAATTGGTCACAAGCTGCTCATTGACGAGTCTTGGGCCGAGTATCGG
GACTACTGGTCATTCTACGACGCAGAGCTCGGCCGAGATGGACCGCCTGGAGACTCAATCGTTGTCACCTCGCGC
CTCCTGAGACGGGACTCAGTCCAGAATTATCGACGTGTCCGCGATGCTGTCGAGATTGTGAGCGGCAAAGCGGGA
GAGGGAACGTTTAACATCGTCGGCCTCGTTTCCGGCGGCAAGATATTGGACGATGAAGTTGACAAGACATCGGGC
TTGAACCCGGCTTGGCATAGCTCACCCCTTCTCCTCATCACAGCTCGGCCGGTATCGAAGACGGCAAGCTCTGTC
GAGCGCCAAGCTGTGATGGACGACATCACCACGGTCAAGGGCGCCGCAACCAAGAGGCTGGCTCAAGATACGGGG
GGCTACATGAACGAGGGCGACCGCAACGATGCCCATTACATCCAGGAATTCTACGGGCGGGCCTACAAGGGCCAT
CTTGAGGCAAAGACTGTGTACGACCCCAGCGGCGTCTTCTATTGTCCGACGTGTGTTGGCGCTGAGGCATTTATC
GACAATCCTCATGGGCCTTTATGCAGTGCCGAGCCGCTCCCACAAACCGAGGCTCGCGCATGA
Transcript >Ophun1|2963
ATGCCCTTGGCCGTCTCATGCTACCCTGGCCCCGACCAAGACATCGAGCGATGCTCTTACGTGAACAGCATGTGG
TCAAACGAGACCTTCCAGACAGGCCAGCCAATGGGCCGTTACTATCCCTACAACATCGCCTGTCCTCCGGTGTAT
GTCGATACAGCATCGGAGCAGCCGAGATGCTCGATAGGGCAGCTTCCGGTCTACAGCGTCAACGTGACAGAACAC
CAAGACATTTCTCAGGCGCTCACCTTTGCGCAGCGGCACAACATCCGGATGACCATCGTCAACACGGGCCACGAC
CTCAACGGCCGGTCCGACGGCTTCGGAAGCCTGGCCATCTGGATCCGCAACCTTCGACGCGGCCTCCACTTCCAG
TATCAATTTTCGTCGGCTACCGGCTGCTCTCGCTCTGGCTGGTCCGGAAGCGCCATCCACATCGACGGCGCCTGG
ACGTGGCGAGAAGTACACCGAGTGGCCCGGCGGAACAATGTCATCGTCGTCGGCGGCGGCTCTGATTCCCCTGGA
GCCACCGGCGGCTGGCTCTCCGGGGGCGGACACGGACCGGCGTCGCGCAATTATGGCCTCGGCGCCGACCAGCTG
CTCGAAGCCCACGTTATGCTTGCAAGCGGACGCGTCGTCATCGCAAACCACTGCCAGCATCGGCTCCTGTTCCGT
GCCCTGCGAGGAGGCGGTCCGGGATACGGAATCGTCCTCGGCACAAAGGTCAAGGCGTATCCCAACGTAGACAAA
GTGACGGCTCACAGGCTCAACGTCTCATCCGTAAGATCCGATTCTGATCTGCTCGATGCCGTAGCCCTTCTGCTG
CAGTCTCATGCGAGACTTGTCGACTCTGGATTCGCTGGATATGCTACTTGGTTCCGTAGCATGCCCGTTGCTGTC
ATGGGCAACTCGTCATCTGGCTACACGCACAGCATGTGGACCATCGGCATGAGCAAGGCTGATGCCGACGCGGCC
CTGAGTCTTTTACGGAAGAAGCTGGCAAGAATTGGTCACAAGCTGCTCATTGACGAGTCTTGGGCCGAGTATCGG
GACTACTGGTCATTCTACGACGCAGAGCTCGGCCGAGATGGACCGCCTGGAGACTCAATCGTTGTCACCTCGCGC
CTCCTGAGACGGGACTCAGTCCAGAATTATCGACGTGTCCGCGATGCTGTCGAGATTGTGAGCGGCAAAGCGGGA
GAGGGAACGTTTAACATCGTCGGCCTCGTTTCCGGCGGCAAGATATTGGACGATGAAGTTGACAAGACATCGGGC
TTGAACCCGGCTTGGCATAGCTCACCCCTTCTCCTCATCACAGCTCGGCCGGTATCGAAGACGGCAAGCTCTGTC
GAGCGCCAAGCTGTGATGGACGACATCACCACGGTCAAGGGCGCCGCAACCAAGAGGCTGGCTCAAGATACGGGG
GGCTACATGAACGAGGGCGACCGCAACGATGCCCATTACATCCAGGAATTCTACGGGCGGGCCTACAAGGGCCAT
CTTGAGGCAAAGACTGTGTACGACCCCAGCGGCGTCTTCTATTGTCCGACGTGTGTTGGCGCTGAGGCATTTATC
GACAATCCTCATGGGCCTTTATGCAGTGCCGAGCCGCTCCCACAAACCGAGGCTCGCGCATGA
Gene >Ophun1|2963
ATGCCCTTGGCCGTCTCATGCTACCCTGGCCCCGACCAAGACATCGAGCGATGCTCTTACGTGAACAGCATGTGG
TCAAACGAGACCTTCCAGACAGGCCAGCCAATGGGCCGTTACTATCCCTACAACATCGCCTGTCCTCCGGTGTAT
GTCGATACAGCATCGGAGCAGCCGAGATGCTCGATAGGGCAGCTTCCGGTCTACAGCGTCAACGTGACAGAACAC
CAAGACATTTCTCAGGCGCTCACCTTTGCGCAGCGGCACAACATCCGGATGACCATCGTCAACACGGGCCACGAC
CTCAACGGCCGGTCCGACGGCTTCGGAAGCCTGGCCATCTGGATCCGCAACCTTCGACGCGGCCTCCACTTCCAG
TATCAATTTTCGTCGGCTACCGGCTGCTCTCGCTCTGGCTGGTCCGGAAGCGCCATCCACATCGACGGCGCCTGG
ACGTGGCGAGAAGTACACCGAGTGGCCCGGCGGAACAATGTCATCGTCGTCGGCGGCGGCTCTGATTCCCCTGGA
GCCACCGGCGGCTGGCTCTCCGGGGGCGGACACGGACCGGCGTCGCGCAATTATGGCCTCGGCGCCGACCAGCTG
CTCGAAGCCCACGTTATGCTTGCAAGCGGACGCGTCGTCATCGCAAACCACTGCCAGCATCGGCTCCTGTTCCGT
GCCCTGCGAGGAGGCGGTCCGGGATACGGAATCGTCCTCGGCACAAAGGTCAAGGCGTATCCCAACGTAGACAAA
GTGACGGCTCACAGGCTCAACGTCTCATCCGTAAGATCCGATTCTGATCTGCTCGATGCCGTAGCCCTTCTGCTG
CAGTCTCATGCGAGACTTGTCGACTCTGGATTCGCTGGATATGCTACTTGGTTCCGTAGCATGCCCGTTGCTGTC
ATGGGCAACTCGTCATCTGGCTACACGCACAGCATGTGGACCATCGGCATGAGCAAGGCTGATGCCGACGCGGCC
CTGAGTCTTTTACGGAAGAAGCTGGCAAGAATTGGTCACAAGCTGCTCATTGACGAGTCTTGGGCCGAGTATCGG
GACTACTGGTCATTCTACGACGCAGAGCTCGGCCGAGATGGACCGCCTGGAGACTCAATCGTTGTCACCTCGCGC
CTCCTGAGACGGGACTCAGTCCAGAATTATCGACGTGTCCGCGATGCTGTCGAGATTGTGAGCGGCAAAGCGGGA
GAGGGAACGTTTAACATCGTCGGCCTCGTTTCCGGCGGCAAGATATTGGACGATGAAGTTGACAAGACATCGGGC
TTGAACCCGGCTTGGCATAGCTCACCCCTTCTCCTCATCACAGCTCGGCCGGTATCGAAGACGGCAAGCTCTGTC
GAGCGCCAAGCTGTGATGGACGACATCACCACGGTCAAGGGCGCCGCAACCAAGAGGCTGGCTCAAGATACGGGG
GGCTACATGAACGAGGGCGACCGCAACGATGCCCATTACATCCAGGAATTCTACGGGCGGGCCTACAAGGGCCAT
CTTGAGGCAAAGACTGTGTACGACCCCAGCGGCGTCTTCTATTGTCCGACGTGTGTTGGCGCTGAGGCATTTATC
GACAATCCTCATGGGCCTTTATGCAGTGCCGAGCCGCTCCCACAAACCGAGGCTCGCGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail