Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2951
Gene name
LocationContig_261:19116..22726
Strand+
Gene length (bp)3610
Transcript length (bp)3546
Coding sequence length (bp)3546
Protein length (aa) 1182

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.1E-37 863 1137
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 7.7E-22 825 1033

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wee1 PE=1 SV=1 818 1161 6.0E-75
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 784 1161 4.0E-52
sp|P32944|SWE1_YEAST Mitosis inhibitor protein kinase SWE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWE1 PE=1 SV=1 815 1062 8.0E-51
sp|P30290|MIK1_SCHPO Mitosis inhibitor protein kinase mik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mik1 PE=3 SV=1 813 1059 1.0E-48
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 815 1053 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wee1 PE=1 SV=1 818 1161 6.0E-75
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 784 1161 4.0E-52
sp|P32944|SWE1_YEAST Mitosis inhibitor protein kinase SWE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWE1 PE=1 SV=1 815 1062 8.0E-51
sp|P30290|MIK1_SCHPO Mitosis inhibitor protein kinase mik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mik1 PE=3 SV=1 813 1059 1.0E-48
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 815 1053 2.0E-38
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 815 1053 2.0E-36
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 817 1053 1.0E-35
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 815 1053 1.0E-35
sp|Q9NI63|PMYT1_DROME Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Drosophila melanogaster GN=Myt1 PE=1 SV=2 794 1055 2.0E-35
sp|Q54F40|Y1133_DICDI Probable protein kinase DDB_G0291133 OS=Dictyostelium discoideum GN=DDB_G0291133 PE=3 SV=1 814 1050 2.0E-33
sp|A4PES0|WEE2_PIG Wee1-like protein kinase 2 OS=Sus scrofa GN=WEE2 PE=1 SV=2 815 1057 2.0E-31
sp|Q6Z829|WEE1_ORYSJ Wee1-like protein kinase OS=Oryza sativa subsp. japonica GN=WEE1 PE=3 SV=1 770 1057 1.0E-30
sp|D2HHP1|WEE2_AILME Wee1-like protein kinase 2 OS=Ailuropoda melanoleuca GN=WEE2 PE=3 SV=1 815 1057 2.0E-30
sp|E2RSS3|WEE2_CANLF Wee1-like protein kinase 2 OS=Canis lupus familiaris GN=WEE2 PE=3 SV=1 815 1057 8.0E-30
sp|Q66JT0|WEE2_MOUSE Wee1-like protein kinase 2 OS=Mus musculus GN=Wee2 PE=1 SV=2 815 1056 2.0E-29
sp|E1BTE1|WEE2_CHICK Wee1-like protein kinase 2 OS=Gallus gallus GN=WEE2 PE=3 SV=1 815 1057 2.0E-29
sp|Q1LX51|WEE2_DANRE Wee1-like protein kinase 2 OS=Danio rerio GN=wee2 PE=2 SV=2 820 1057 9.0E-29
sp|P0C1S8|WEE2_HUMAN Wee1-like protein kinase 2 OS=Homo sapiens GN=WEE2 PE=2 SV=2 815 1120 1.0E-28
sp|A4QNA8|WEE2_XENTR Wee1-like protein kinase 2 OS=Xenopus tropicalis GN=wee2 PE=2 SV=1 815 1057 1.0E-27
sp|Q8QGV2|WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis GN=wee1-b PE=1 SV=1 755 1059 1.0E-26
sp|P47817|WEE2A_XENLA Wee1-like protein kinase 2-A OS=Xenopus laevis GN=wee2-a PE=1 SV=2 815 1059 3.0E-26
sp|Q8AYK6|WEE1A_XENLA Wee1-like protein kinase 1-A OS=Xenopus laevis GN=wee1-a PE=2 SV=1 752 1077 4.0E-26
sp|P47810|WEE1_MOUSE Wee1-like protein kinase OS=Mus musculus GN=Wee1 PE=1 SV=2 813 1069 1.0E-25
sp|Q6DFE0|WEE2C_XENLA Wee1-like protein kinase 2-C OS=Xenopus laevis GN=wee2-c PE=2 SV=1 813 1057 1.0E-25
sp|O57473|WEE2B_XENLA Wee1-like protein kinase 2-B OS=Xenopus laevis GN=wee2-b PE=1 SV=1 813 1057 2.0E-25
sp|P30291|WEE1_HUMAN Wee1-like protein kinase OS=Homo sapiens GN=WEE1 PE=1 SV=2 813 1059 4.0E-25
sp|Q63802|WEE1_RAT Wee1-like protein kinase OS=Rattus norvegicus GN=Wee1 PE=1 SV=1 813 1059 9.0E-25
sp|Q626B1|PMY13_CAEBR Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis briggsae GN=wee-1.3 PE=3 SV=1 813 1055 2.0E-24
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 816 1053 1.0E-23
sp|Q8L4H0|WEE1_ARATH Wee1-like protein kinase OS=Arabidopsis thaliana GN=WEE1 PE=1 SV=1 770 1077 2.0E-21
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 776 1054 5.0E-21
sp|P54350|WEE1_DROME Wee1-like protein kinase OS=Drosophila melanogaster GN=Wee1 PE=1 SV=2 815 1060 2.0E-20
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 804 1033 1.0E-19
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 852 1076 5.0E-19
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 828 1031 7.0E-19
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 837 1033 2.0E-18
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 820 1059 5.0E-18
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 808 1031 7.0E-18
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 796 1033 1.0E-17
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 821 1031 1.0E-17
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 867 1031 1.0E-17
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 814 1031 2.0E-17
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 805 1061 2.0E-17
sp|Q20085|PMY11_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.1 OS=Caenorhabditis elegans GN=wee-1.1 PE=2 SV=2 900 1055 4.0E-17
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 862 1034 6.0E-17
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 882 1031 6.0E-17
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 803 1061 9.0E-17
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 793 1057 9.0E-17
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 828 1031 1.0E-16
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 822 1032 1.0E-16
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 805 1061 1.0E-16
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 826 1031 1.0E-16
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 818 1033 2.0E-16
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 882 1031 2.0E-16
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 822 1033 2.0E-16
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 805 1061 2.0E-16
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 862 1031 2.0E-16
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 818 1035 2.0E-16
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 822 1032 3.0E-16
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 882 1033 4.0E-16
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 805 1061 5.0E-16
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 882 1031 5.0E-16
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 865 1031 6.0E-16
sp|Q9M1Z9|LRK58_ARATH Putative L-type lectin-domain containing receptor kinase V.8 OS=Arabidopsis thaliana GN=LECRK58 PE=3 SV=1 822 1034 6.0E-16
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 887 1056 6.0E-16
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 822 1035 9.0E-16
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 863 1031 9.0E-16
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 818 1056 1.0E-15
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 887 1056 1.0E-15
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 807 1056 1.0E-15
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 817 1143 1.0E-15
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 887 1056 1.0E-15
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 816 1043 1.0E-15
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 882 1031 1.0E-15
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 852 1033 2.0E-15
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 814 1056 2.0E-15
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 789 1048 2.0E-15
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 821 1033 2.0E-15
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 821 1035 2.0E-15
sp|O04534|LRK51_ARATH Putative L-type lectin-domain containing receptor kinase V.1 OS=Arabidopsis thaliana GN=LECRK51 PE=3 SV=1 822 1034 2.0E-15
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 887 1056 2.0E-15
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 822 1033 2.0E-15
sp|O70146|TESK1_MOUSE Dual specificity testis-specific protein kinase 1 OS=Mus musculus GN=Tesk1 PE=1 SV=3 822 1036 2.0E-15
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 817 1036 2.0E-15
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 826 1034 2.0E-15
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 821 1031 2.0E-15
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 819 1033 3.0E-15
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 810 1049 3.0E-15
sp|Q63572|TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus GN=Tesk1 PE=1 SV=1 822 1036 3.0E-15
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 818 1035 3.0E-15
sp|O43077|MDE3_SCHPO Sporulation protein kinase mde3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde3 PE=3 SV=1 821 1034 4.0E-15
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 847 1033 4.0E-15
sp|Q96285|LRK55_ARATH L-type lectin-domain containing receptor kinase V.5 OS=Arabidopsis thaliana GN=LECRK55 PE=1 SV=1 822 1034 5.0E-15
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 819 1031 5.0E-15
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 822 1033 5.0E-15
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 822 1033 5.0E-15
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 864 1035 6.0E-15
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 824 1034 6.0E-15
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 807 1033 6.0E-15
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 861 1037 7.0E-15
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 822 1033 7.0E-15
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 828 1031 8.0E-15
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 814 1056 8.0E-15
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 887 1056 9.0E-15
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 817 1036 1.0E-14
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 882 1031 1.0E-14
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 805 1031 1.0E-14
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 822 1033 1.0E-14
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 822 1033 1.0E-14
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 862 1031 1.0E-14
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 822 1033 1.0E-14
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 822 1033 1.0E-14
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 882 1031 1.0E-14
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 882 1031 1.0E-14
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 822 1033 1.0E-14
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 822 1033 1.0E-14
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 868 1031 1.0E-14
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 882 1031 1.0E-14
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 822 1033 1.0E-14
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 817 1033 1.0E-14
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 821 1033 2.0E-14
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 887 1066 2.0E-14
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 822 1033 2.0E-14
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 821 1034 2.0E-14
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 828 1031 2.0E-14
sp|Q54ZN3|Y0004_DICDI Probable protein kinase DDB_G0277539 OS=Dictyostelium discoideum GN=DDB_G0277539 PE=3 SV=1 822 978 2.0E-14
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 822 1033 2.0E-14
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 818 1138 2.0E-14
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 821 1034 2.0E-14
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 822 1033 2.0E-14
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 828 1031 2.0E-14
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 817 1036 2.0E-14
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 822 1034 2.0E-14
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 821 1035 2.0E-14
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 879 1029 3.0E-14
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 820 1032 3.0E-14
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 822 1032 4.0E-14
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 822 1032 4.0E-14
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 822 1033 4.0E-14
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 887 1028 5.0E-14
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 881 1054 5.0E-14
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 887 1029 5.0E-14
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 821 1031 5.0E-14
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 814 1031 5.0E-14
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 822 1031 6.0E-14
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 864 1038 6.0E-14
sp|Q9ZR79|LRK57_ARATH L-type lectin-domain containing receptor kinase V.7 OS=Arabidopsis thaliana GN=LECRK57 PE=2 SV=2 822 1034 7.0E-14
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 822 1033 7.0E-14
sp|Q9JIH7|WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus GN=Wnk1 PE=1 SV=2 814 1035 8.0E-14
sp|Q9H4A3|WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens GN=WNK1 PE=1 SV=2 814 1035 9.0E-14
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 821 1035 9.0E-14
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 826 1033 9.0E-14
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 687 1031 9.0E-14
sp|O14328|KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksp1 PE=1 SV=1 886 1045 1.0E-13
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 816 1031 1.0E-13
sp|P83741|WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus GN=Wnk1 PE=1 SV=2 814 1035 1.0E-13
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 820 1032 1.0E-13
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 819 1033 1.0E-13
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 813 1034 1.0E-13
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 822 1034 1.0E-13
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 882 1031 1.0E-13
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 822 1032 1.0E-13
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 887 1036 1.0E-13
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 821 1031 1.0E-13
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 821 1033 1.0E-13
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 822 1034 1.0E-13
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 821 1034 1.0E-13
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 886 1031 1.0E-13
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 887 1029 2.0E-13
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 822 1033 2.0E-13
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 822 1033 2.0E-13
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 820 1032 2.0E-13
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 818 1033 2.0E-13
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 822 1031 2.0E-13
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 887 1028 2.0E-13
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 818 1034 2.0E-13
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 813 1034 2.0E-13
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 813 1034 2.0E-13
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 808 1028 2.0E-13
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 809 1031 2.0E-13
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 821 1031 2.0E-13
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 822 1033 2.0E-13
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 822 1033 3.0E-13
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 820 1032 3.0E-13
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 814 1032 3.0E-13
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 887 1028 3.0E-13
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 821 1031 3.0E-13
sp|Q80UE6|WNK4_MOUSE Serine/threonine-protein kinase WNK4 OS=Mus musculus GN=Wnk4 PE=1 SV=1 809 1035 3.0E-13
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 822 1034 3.0E-13
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 821 1031 3.0E-13
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 818 1033 3.0E-13
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 887 1030 3.0E-13
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 807 1056 3.0E-13
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 882 1031 3.0E-13
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 813 1031 3.0E-13
sp|Q7TPK6|WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus GN=Wnk4 PE=1 SV=3 809 1035 3.0E-13
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 821 1033 3.0E-13
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 821 1033 3.0E-13
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 821 1033 3.0E-13
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 822 1034 4.0E-13
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 847 1031 4.0E-13
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 820 1031 4.0E-13
sp|Q96J92|WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens GN=WNK4 PE=1 SV=1 814 1035 4.0E-13
sp|O04533|LRK52_ARATH Putative L-type lectin-domain containing receptor kinase V.2 OS=Arabidopsis thaliana GN=LECRK52 PE=3 SV=1 867 1034 4.0E-13
sp|Q9SZD5|LRK59_ARATH L-type lectin-domain containing receptor kinase V.9 OS=Arabidopsis thaliana GN=LECRK59 PE=2 SV=1 822 1034 4.0E-13
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 847 1031 4.0E-13
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 821 1033 4.0E-13
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 828 1031 5.0E-13
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 812 1033 5.0E-13
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 865 1031 5.0E-13
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 847 1031 5.0E-13
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 809 1028 5.0E-13
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 822 1032 5.0E-13
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 847 1031 5.0E-13
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 826 1033 5.0E-13
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 821 1033 5.0E-13
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 822 1034 5.0E-13
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 882 1035 6.0E-13
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 865 1031 6.0E-13
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 822 1033 6.0E-13
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 861 1032 7.0E-13
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 888 1031 7.0E-13
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 865 1031 7.0E-13
sp|O22833|LRK54_ARATH L-type lectin-domain containing receptor kinase V.4 OS=Arabidopsis thaliana GN=LECRK54 PE=2 SV=1 826 1034 7.0E-13
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 803 1034 8.0E-13
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 822 1033 8.0E-13
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 821 1034 8.0E-13
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 815 1031 8.0E-13
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 828 1034 8.0E-13
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 820 1059 9.0E-13
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 828 1031 9.0E-13
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 897 1031 9.0E-13
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 822 1032 9.0E-13
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 821 1033 9.0E-13
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 819 1033 9.0E-13
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 821 1031 1.0E-12
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 882 1033 1.0E-12
sp|Q24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster GN=Dsor1 PE=1 SV=2 826 1036 1.0E-12
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 817 1031 1.0E-12
sp|Q9VWQ2|S6KL_DROME Serine/threonine-protein kinase S6KL OS=Drosophila melanogaster GN=S6KL PE=1 SV=1 828 1031 1.0E-12
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 865 1028 1.0E-12
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 817 1033 1.0E-12
sp|Q54RR9|Y9844_DICDI Probable serine/threonine-protein kinase DDB_G0282963 OS=Dictyostelium discoideum GN=DDB_G0282963 PE=3 SV=1 825 1037 1.0E-12
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 809 1028 1.0E-12
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 821 1034 1.0E-12
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 815 1031 1.0E-12
sp|Q9LHI7|NEK7_ARATH Serine/threonine-protein kinase Nek7 OS=Arabidopsis thaliana GN=NEK7 PE=2 SV=1 867 1035 2.0E-12
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 865 1031 2.0E-12
sp|P45984|MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens GN=MAPK9 PE=1 SV=2 815 1038 2.0E-12
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 880 1031 2.0E-12
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 880 1031 2.0E-12
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 865 1031 2.0E-12
sp|Q4WPF2|ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg1 PE=3 SV=1 821 1031 2.0E-12
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 828 1028 2.0E-12
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 881 1034 2.0E-12
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 887 1036 2.0E-12
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 882 1033 2.0E-12
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 809 1028 2.0E-12
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 821 1033 2.0E-12
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 821 1033 2.0E-12
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 818 1059 2.0E-12
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 882 1033 2.0E-12
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 821 1033 2.0E-12
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 847 1054 2.0E-12
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 796 1033 2.0E-12
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 809 1028 3.0E-12
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 821 1033 3.0E-12
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 822 1031 3.0E-12
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 822 1053 3.0E-12
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 847 1033 3.0E-12
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 898 1033 3.0E-12
sp|A1CX69|ATG1_NEOFI Serine/threonine-protein kinase atg1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg1 PE=3 SV=1 821 1031 3.0E-12
sp|P0CY25|STE7_CANAX Serine/threonine-protein kinase STE7 homolog OS=Candida albicans GN=STE7 PE=3 SV=1 886 1045 3.0E-12
sp|C4YLK8|STE7_CANAW Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain WO-1) GN=HST7 PE=3 SV=1 886 1045 3.0E-12
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 822 1033 3.0E-12
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 821 1034 3.0E-12
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 828 1028 3.0E-12
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 822 1032 3.0E-12
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 821 1033 3.0E-12
sp|Q8NU97|PKN2_CORGL Serine/threonine-protein kinases PknA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknA PE=3 SV=1 898 1034 3.0E-12
sp|O65479|CRK20_ARATH Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2 863 1061 3.0E-12
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 863 1031 4.0E-12
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 863 1031 4.0E-12
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 822 1033 4.0E-12
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 847 1054 4.0E-12
sp|Q9WTU6|MK09_MOUSE Mitogen-activated protein kinase 9 OS=Mus musculus GN=Mapk9 PE=1 SV=2 827 1038 4.0E-12
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 865 1031 4.0E-12
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 852 1031 4.0E-12
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 822 1033 4.0E-12
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 822 1031 4.0E-12
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 821 1096 4.0E-12
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 875 1031 4.0E-12
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 815 1034 4.0E-12
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 887 1031 4.0E-12
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 821 1031 5.0E-12
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 822 1031 5.0E-12
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 880 1033 5.0E-12
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 833 1031 5.0E-12
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 816 1033 5.0E-12
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 822 1033 5.0E-12
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 822 1031 5.0E-12
sp|Q5A6T5|STE7_CANAL Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST7 PE=3 SV=1 886 1045 5.0E-12
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 867 1057 6.0E-12
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 822 1031 6.0E-12
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 865 1031 6.0E-12
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 865 1031 6.0E-12
sp|O22834|LRK53_ARATH Probable L-type lectin-domain containing receptor kinase V.3 OS=Arabidopsis thaliana GN=LECRK53 PE=3 SV=1 867 1035 6.0E-12
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 847 1054 6.0E-12
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 820 1031 6.0E-12
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 863 1031 6.0E-12
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 817 1031 6.0E-12
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 820 1031 7.0E-12
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 827 1031 7.0E-12
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 822 1028 7.0E-12
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 887 1034 7.0E-12
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 882 1033 7.0E-12
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 820 1042 8.0E-12
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 822 1028 8.0E-12
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 863 1033 8.0E-12
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 821 1034 8.0E-12
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 828 1053 9.0E-12
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 820 1042 9.0E-12
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 828 1053 9.0E-12
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 887 1031 1.0E-11
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 822 1031 1.0E-11
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 822 1075 1.0E-11
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 822 1028 1.0E-11
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 820 1031 1.0E-11
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 862 1044 1.0E-11
sp|Q09815|PPK5_SCHPO Serine/threonine-protein kinase ppk5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk5 PE=1 SV=1 818 1036 1.0E-11
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 822 1031 1.0E-11
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 887 1031 1.0E-11
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 822 1031 1.0E-11
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 822 1031 1.0E-11
sp|P49186|MK09_RAT Mitogen-activated protein kinase 9 OS=Rattus norvegicus GN=Mapk9 PE=1 SV=1 827 1038 1.0E-11
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 822 1031 1.0E-11
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 822 1031 1.0E-11
sp|D7SFH9|GPDL2_ARATH Glycerophosphodiester phosphodiesterase protein kinase domain-containing GDPDL2 OS=Arabidopsis thaliana GN=GDPDL2 PE=1 SV=1 826 1031 1.0E-11
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 820 1031 1.0E-11
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 822 1028 1.0E-11
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 822 1028 1.0E-11
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 863 1033 1.0E-11
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 887 1028 1.0E-11
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 882 1031 2.0E-11
sp|Q9CAL3|CRK2_ARATH Cysteine-rich receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=2 SV=1 822 1061 2.0E-11
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 814 1031 2.0E-11
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 804 1028 2.0E-11
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 888 1033 2.0E-11
sp|A8C984|MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio GN=mylk3 PE=2 SV=1 825 1029 2.0E-11
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 882 1031 2.0E-11
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 887 1033 2.0E-11
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 880 1031 2.0E-11
sp|Q8S9L6|CRK29_ARATH Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana GN=CRK29 PE=2 SV=1 822 1031 2.0E-11
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 822 1030 2.0E-11
sp|P32581|IME2_YEAST Meiosis induction protein kinase IME2/SME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IME2 PE=3 SV=1 817 1034 2.0E-11
sp|Q54VC0|Y9865_DICDI Probable serine/threonine-protein kinase DDB_G0280461 OS=Dictyostelium discoideum GN=DDB_G0280461 PE=3 SV=1 887 1031 2.0E-11
sp|Q63638|SPEG_RAT Striated muscle-specific serine/threonine-protein kinase OS=Rattus norvegicus GN=Speg PE=1 SV=2 886 1029 2.0E-11
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 822 1031 2.0E-11
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 824 1033 2.0E-11
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 817 1031 2.0E-11
sp|Q8VCR8|MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus GN=Mylk2 PE=1 SV=2 805 1029 2.0E-11
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 821 1049 2.0E-11
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 820 1031 2.0E-11
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 818 1037 2.0E-11
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 812 1031 2.0E-11
sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPS1 PE=1 SV=2 809 1031 2.0E-11
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 791 1033 2.0E-11
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 820 1033 2.0E-11
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 821 1049 2.0E-11
sp|Q9QZ05|E2AK4_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Mus musculus GN=Eif2ak4 PE=1 SV=2 913 1035 2.0E-11
sp|Q91447|MP2K1_SERCA Dual specificity mitogen-activated protein kinase kinase 1 (Fragment) OS=Serinus canaria GN=MAP2K1 PE=2 SV=1 822 1033 3.0E-11
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 822 1049 3.0E-11
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 773 1031 3.0E-11
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 818 1031 3.0E-11
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 818 1031 3.0E-11
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 822 1033 3.0E-11
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 822 1049 3.0E-11
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 883 1048 3.0E-11
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 815 1051 3.0E-11
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 828 1031 3.0E-11
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 818 1031 3.0E-11
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 822 1034 3.0E-11
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 828 1053 3.0E-11
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 879 1028 3.0E-11
sp|Q19192|E2AKA_CAEEL Eukaryotic translation initiation factor 2-alpha kinase pek-1 OS=Caenorhabditis elegans GN=pek-1 PE=1 SV=2 913 1031 4.0E-11
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 816 1033 4.0E-11
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 852 1034 4.0E-11
sp|Q54UL8|MPS1_DICDI Probable serine/threonine-protein kinase mps1 OS=Dictyostelium discoideum GN=mps1 PE=3 SV=1 822 1033 4.0E-11
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 847 1033 4.0E-11
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 839 1033 4.0E-11
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 817 1036 4.0E-11
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 881 1034 4.0E-11
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 820 1034 4.0E-11
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 822 1028 4.0E-11
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 822 1031 5.0E-11
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 818 1051 5.0E-11
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 822 1031 5.0E-11
sp|Q05116|MP2K1_XENLA Dual specificity mitogen-activated protein kinase kinase 1 OS=Xenopus laevis GN=map2k1 PE=1 SV=2 822 1033 5.0E-11
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 812 1031 5.0E-11
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 808 1083 5.0E-11
sp|Q62407|SPEG_MOUSE Striated muscle-specific serine/threonine-protein kinase OS=Mus musculus GN=Speg PE=1 SV=2 886 1029 5.0E-11
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 828 1028 5.0E-11
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 866 1031 6.0E-11
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 913 1033 6.0E-11
sp|Q95QC4|DCLK_CAEEL Serine/threonine-protein kinase zyg-8 OS=Caenorhabditis elegans GN=zyg-8 PE=1 SV=1 818 1028 6.0E-11
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 888 1034 6.0E-11
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 828 1031 6.0E-11
sp|Q9USS2|PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk29 PE=1 SV=1 826 1028 6.0E-11
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 821 1031 6.0E-11
sp|Q9KIG4|PK1_STRTO Serine/threonine-protein kinase PK-1 OS=Streptomyces toyocaensis GN=spk1 PE=1 SV=1 886 1031 6.0E-11
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 886 1029 6.0E-11
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 812 1031 6.0E-11
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 812 1031 6.0E-11
sp|Q550L8|IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum GN=ifkB PE=2 SV=1 914 989 6.0E-11
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 822 1033 6.0E-11
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 900 1031 6.0E-11
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 820 1031 7.0E-11
sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3 818 1029 7.0E-11
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 828 1028 7.0E-11
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 820 1031 7.0E-11
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 820 1031 7.0E-11
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 826 1033 7.0E-11
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 852 1031 8.0E-11
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 887 1031 8.0E-11
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 818 1049 8.0E-11
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 818 1031 8.0E-11
sp|Q558U1|IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum GN=ifkA PE=2 SV=1 914 989 8.0E-11
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 815 1029 8.0E-11
sp|Q01986|MP2K1_RAT Dual specificity mitogen-activated protein kinase kinase 1 OS=Rattus norvegicus GN=Map2k1 PE=1 SV=2 822 1034 8.0E-11
sp|P31938|MP2K1_MOUSE Dual specificity mitogen-activated protein kinase kinase 1 OS=Mus musculus GN=Map2k1 PE=1 SV=2 822 1034 9.0E-11
sp|P29678|MP2K1_RABIT Dual specificity mitogen-activated protein kinase kinase 1 OS=Oryctolagus cuniculus GN=MAP2K1 PE=1 SV=2 822 1034 9.0E-11
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 815 1028 1.0E-10
sp|Q6BM25|SSN3_DEBHA Serine/threonine-protein kinase SSN3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SSN3 PE=3 SV=2 814 1031 1.0E-10
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 827 1056 1.0E-10
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 805 1029 1.0E-10
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 815 1028 1.0E-10
sp|Q02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens GN=MAP2K1 PE=1 SV=2 822 1034 1.0E-10
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 815 1029 1.0E-10
sp|Q6NU98|PDK1B_XENLA Serine/threonine-protein kinase pdik1l-B OS=Xenopus laevis GN=pdik1-b PE=2 SV=1 821 1040 1.0E-10
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 822 1033 1.0E-10
sp|Q63980|MP2K1_CRIGR Dual specificity mitogen-activated protein kinase kinase 1 OS=Cricetulus griseus GN=MAP2K1 PE=1 SV=1 822 1034 1.0E-10
sp|Q9XID3|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300 OS=Arabidopsis thaliana GN=At1g34300 PE=2 SV=1 826 1157 1.0E-10
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 815 1034 1.0E-10
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 827 1031 1.0E-10
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 892 1031 1.0E-10
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 818 1033 1.0E-10
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 822 1031 1.0E-10
sp|Q9LV37|MPK9_ARATH Mitogen-activated protein kinase 9 OS=Arabidopsis thaliana GN=MPK9 PE=2 SV=2 819 1031 1.0E-10
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 820 1031 1.0E-10
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 814 1026 1.0E-10
sp|P10506|BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr1 PE=1 SV=1 854 1033 1.0E-10
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 822 1033 1.0E-10
sp|P06784|STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE7 PE=1 SV=1 886 1034 1.0E-10
sp|O61443|MK14B_DROME Mitogen-activated protein kinase 14B OS=Drosophila melanogaster GN=p38b PE=1 SV=1 868 1031 1.0E-10
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 805 1029 1.0E-10
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 815 1029 2.0E-10
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 815 1028 2.0E-10
sp|O02827|MYLK_SHEEP Myosin light chain kinase, smooth muscle (Fragment) OS=Ovis aries GN=MYLK PE=2 SV=1 877 1061 2.0E-10
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 865 1034 2.0E-10
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 799 1031 2.0E-10
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 819 1036 2.0E-10
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 808 1033 2.0E-10
sp|Q5J4W4|MPK2_ORYSJ Mitogen-activated protein kinase 2 OS=Oryza sativa subsp. japonica GN=MPK2 PE=2 SV=1 856 1033 2.0E-10
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 815 1034 2.0E-10
sp|Q8VCT9|TESK2_MOUSE Dual specificity testis-specific protein kinase 2 OS=Mus musculus GN=Tesk2 PE=1 SV=1 826 1036 2.0E-10
sp|Q9SYS7|CRK39_ARATH Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana GN=CRK39 PE=3 SV=1 819 1034 2.0E-10
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 864 1033 2.0E-10
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 806 1032 2.0E-10
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 886 1027 2.0E-10
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 818 1030 2.0E-10
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 886 1027 2.0E-10
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 822 1033 2.0E-10
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 882 1048 2.0E-10
sp|A1DES4|MPKC_NEOFI Mitogen-activated protein kinase mpkC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mpkc PE=3 SV=2 864 1031 2.0E-10
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 822 1031 2.0E-10
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 822 1033 2.0E-10
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 828 1028 2.0E-10
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 807 1033 2.0E-10
sp|Q8QHK8|MK08_XENLA Mitogen-activated protein kinase 8 OS=Xenopus laevis GN=mapk8 PE=2 SV=2 825 1038 2.0E-10
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 887 1048 2.0E-10
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 822 1030 2.0E-10
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 915 1035 2.0E-10
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 915 1035 2.0E-10
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 915 1035 2.0E-10
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 915 1035 2.0E-10
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 822 1033 2.0E-10
sp|Q9SR87|LRK61_ARATH Probable L-type lectin-domain containing receptor kinase VI.1 OS=Arabidopsis thaliana GN=LECRK61 PE=2 SV=1 819 1034 2.0E-10
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 887 1031 2.0E-10
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 819 1036 2.0E-10
sp|Q99078|FUZ7_USTMA Dual specificity protein kinase FUZ7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FUZ7 PE=3 SV=2 879 1033 2.0E-10
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 822 1033 2.0E-10
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 808 1031 2.0E-10
sp|Q61831|MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus GN=Mapk10 PE=1 SV=2 816 1038 2.0E-10
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 815 1034 2.0E-10
sp|Q80ZW0|STK35_MOUSE Serine/threonine-protein kinase 35 OS=Mus musculus GN=Stk35 PE=1 SV=3 877 1041 2.0E-10
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 888 1033 2.0E-10
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 815 1034 3.0E-10
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 820 1028 3.0E-10
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 828 1028 3.0E-10
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 812 1031 3.0E-10
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 818 1030 8.0E-10
sp|Q63638|SPEG_RAT Striated muscle-specific serine/threonine-protein kinase OS=Rattus norvegicus GN=Speg PE=1 SV=2 818 1030 3.0E-09
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 888 1052 3.0E-08
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 901 1036 9.0E-08
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 888 1044 4.0E-07
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 888 1044 5.0E-07
sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3 876 1027 6.0E-07
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 888 1044 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2951
MSFSNSAGGTLALPSPTHAHHMDVTSAVRSLRRSISKSPSKLLTRTASQSSSESSRQASSPQSPCRRRFGSTPSR
PSLSPSHPHTAPPAFTSSHATNPLSTFTPLRPSVRLSLRSTKSAKTSSPSRPLARARVSPKSPLKRALNDIPDSG
NALHPASPSCSPSPGQENGRGSSSTPRRHLDKPARHSVHLDVSGAASQYSFLKALDTAESYMVSTTGALKRSDAT
MNLDHPNQGSPVAKRRSLHGISGIGQAQDLDDVLCGNTDATQHFEIHEDSPSDEYELTGSPDADQADAPPSPVRR
DPSASPSPASSNMPKRSSSLRRSTLQQRHGDKGSLGRRNGERQLAQMTPETSTPLRHRPRLSTDHFLPPLGNREC
LFSTAPSLYPSIHQAEAKGPHPLSRTLTTSTSGNSLDEEECKGTAVPVAPTAVKAPEKPKPHPFSRSLPLNATRP
APAAVRPANEHVKGIATPNQSQLWIGAFHSTGLVSKVNRNPEEEAEKKLAPPDTPCKKHANPFATFPPPAAGSAI
KRKNHNRNSFAGVPSTPFSRSSGRGAETFGGAPGKGLSIFQRGSAAHHSRRGSVLGLDTEPEDRMLFGEAPELFS
NLMDGDAPPTPTKNALTPSLSNLSEQSLESPSANRTFSLPLSAIKPAAAWRESLAAKSKPDASAQSKERDDDAMA
HGGVGRAAVTTTAQDRQPSPTPCLAPRSSFGRSRFVKGLNAPSPLAAPQSPHLVIPRSENGFAKFTSVEPPTDGR
RTPQTPQETLLPLDTSRLSISQAPEGLGENSMPPPVTPTAGRDFRSSTCSFVTPVNGRTSNLDVDTSLSSRFDKV
EQVGKGEFSTVYRVSRLEPANGDVTPGEDASALSPAHGQQVFAVKKSKHSYHGPKDRELKLREVGILQALTHAEH
VVQYVDSWEHNFHLYIQTEFCEEGTLDRFLGNVGRGGRLDDFRIFKILQDLSLGLKEIHDAGFMHLDMKPANILI
SFEGALKIGDFGLAQPCSSAEGVDVEGDREYMAPEMLRGKAGLAADIFSLGLMTLEAAANVVLPDNGPTWIALRS
GDLSEVPSLTWTPSIEVERDATGKPSSHSSDELDGGSPPLFGSFKRSELQQPPDFMVEAFHPSSLDSIVRWMTAE
APADRPLVDQVLDLEGLRWVAEHRNAPATVYEGNWGPVDVFPVSIAGDSDTEMTDV*
Coding >Ophun1|2951
ATGTCCTTCTCCAACAGCGCCGGAGGCACCTTGGCACTGCCGTCGCCGACACACGCCCATCACATGGACGTGACG
TCGGCCGTCCGCAGTCTACGTCGATCCATCTCAAAGTCGCCCTCAAAGCTCCTGACGCGTACCGCCTCGCAGAGC
TCCTCCGAAAGCTCCCGCCAGGCCTCTTCGCCCCAGTCGCCCTGCCGCAGACGCTTCGGCTCGACGCCCTCGCGC
CCGTCGCTGTCGCCTTCGCACCCTCATACGGCCCCGCCGGCCTTCACCTCGTCACACGCCACCAACCCGTTATCT
ACCTTTACGCCGCTGCGCCCCAGCGTCAGGCTGTCGCTGCGCTCGACCAAGTCGGCCAAGACATCGTCGCCGTCA
CGACCCCTTGCGCGCGCCCGTGTCTCGCCCAAGAGCCCCCTGAAGCGAGCCCTCAACGACATCCCCGACTCGGGC
AACGCCCTCCACCCGGCCTCGCCCTCGTGCTCGCCCTCGCCAGGCCAGGAGAACGGCAGGGGCTCGTCGTCGACG
CCGCGCAGGCACCTCGACAAGCCAGCCCGTCACAGCGTCCACCTCGATGTGTCGGGCGCCGCCTCGCAATACTCA
TTCCTCAAAGCTCTCGACACGGCCGAGTCCTACATGGTGTCGACCACGGGCGCGCTGAAGCGCAGTGATGCCACC
ATGAACCTCGATCACCCCAACCAAGGGAGCCCCGTCGCCAAGCGCCGCAGCCTGCACGGTATCTCGGGCATCGGC
CAGGCCCAGGACCTCGACGACGTCCTCTGCGGTAATACCGACGCCACGCAACACTTTGAAATCCACGAGGACTCG
CCCTCGGACGAGTACGAGCTGACGGGCTCGCCTGACGCTGACCAAGCGGACGCGCCTCCCTCGCCTGTCCGTCGC
GACCCGTCGGCCTCGCCGTCTCCCGCCTCGTCCAACATGCCCAAGCGGTCCTCGTCGCTCCGCCGTTCGACGCTC
CAGCAGCGGCACGGGGACAAGGGCTCACTGGGCAGGAGGAACGGCGAGCGCCAGCTGGCCCAGATGACGCCCGAG
ACGTCGACGCCGCTACGGCACCGCCCCCGCCTGTCGACGGACCACTTCCTGCCCCCCTTGGGCAACCGAGAATGC
CTCTTCTCGACGGCGCCCTCCCTGTATCCATCCATTCACCAGGCCGAGGCCAAGGGTCCGCATCCGCTCTCCAGG
ACCTTGACAACATCGACGTCGGGCAACAGCCTCGACGAAGAGGAGTGCAAGGGCACGGCGGTCCCCGTCGCCCCT
ACCGCTGTCAAGGCGCCGGAGAAGCCCAAACCGCACCCCTTCTCTCGCTCTCTCCCTCTCAACGCCACCAGGCCC
GCCCCGGCCGCCGTCCGCCCCGCCAACGAGCACGTCAAGGGGATCGCGACGCCGAACCAGTCTCAGCTATGGATC
GGCGCCTTTCACTCCACCGGCCTCGTCTCAAAGGTCAACCGGAACCCCGAGGAGGAGGCCGAGAAGAAGCTCGCG
CCTCCCGATACGCCGTGCAAGAAGCACGCCAACCCGTTCGCCACCTTTCCGCCCCCGGCGGCTGGCAGCGCCATC
AAGAGAAAGAATCACAACCGCAACTCGTTCGCCGGCGTGCCCTCTACGCCCTTTAGCCGCTCCTCGGGCAGGGGA
GCCGAGACGTTTGGCGGCGCTCCGGGGAAGGGGCTTTCCATCTTCCAGCGCGGGTCGGCCGCTCATCACTCGCGC
CGCGGCAGCGTCCTCGGTCTCGACACCGAACCCGAGGACCGCATGCTCTTCGGCGAGGCCCCCGAGCTCTTCAGC
AACCTGATGGACGGCGACGCGCCGCCCACGCCGACCAAGAACGCCCTCACGCCCAGTCTCAGCAACCTCAGCGAA
CAGTCGCTGGAAAGCCCGAGCGCTAACCGCACCTTTTCCCTGCCGCTGTCGGCCATCAAGCCCGCTGCCGCCTGG
CGCGAGTCGTTGGCGGCCAAGTCGAAGCCGGACGCGTCGGCGCAGTCCAAGGAGCGCGACGATGACGCCATGGCT
CACGGCGGCGTCGGCCGAGCCGCCGTCACTACGACGGCTCAGGATCGCCAGCCGTCGCCCACGCCGTGCCTCGCG
CCGCGGTCTTCGTTTGGCAGGTCGAGGTTCGTCAAGGGGCTCAACGCGCCGTCGCCCCTGGCAGCTCCCCAGTCT
CCGCATCTGGTGATTCCGCGCTCGGAGAATGGATTCGCCAAGTTCACCTCGGTCGAACCGCCGACGGACGGGCGG
AGGACGCCGCAGACGCCTCAGGAGACGCTGCTCCCGCTCGACACGAGCCGGCTGTCCATCTCGCAGGCGCCAGAG
GGCTTGGGCGAGAACAGCATGCCGCCACCCGTGACGCCCACGGCCGGGCGCGACTTTCGGTCCTCGACTTGCAGC
TTCGTGACGCCCGTCAACGGCCGGACGAGCAACCTCGACGTCGACACCAGCCTCTCGTCGCGGTTCGACAAGGTC
GAGCAGGTGGGCAAGGGCGAGTTCTCGACTGTCTACCGCGTCAGCCGGCTGGAGCCCGCCAACGGCGACGTGACG
CCCGGCGAGGACGCGTCGGCGCTCAGTCCCGCGCACGGCCAGCAGGTCTTTGCGGTCAAGAAGAGCAAGCACTCG
TACCACGGGCCCAAGGATCGCGAACTCAAGCTCCGCGAGGTGGGCATCCTCCAGGCGCTGACGCACGCCGAGCAT
GTTGTGCAATATGTCGACAGCTGGGAACACAATTTCCATTTGTATATACAGACGGAGTTCTGCGAGGAGGGGACC
CTGGACAGATTTTTGGGCAATGTCGGACGAGGCGGGAGGTTGGATGACTTCCGCATCTTCAAGATCTTGCAGGAT
CTCAGCCTGGGTCTCAAGGAGATTCACGACGCCGGGTTTATGCACCTGGACATGAAGCCGGCCAACATCCTCATC
AGCTTCGAGGGCGCGCTCAAGATTGGCGACTTTGGGCTGGCCCAGCCGTGCTCGTCGGCCGAGGGCGTCGACGTC
GAGGGCGATCGCGAATACATGGCGCCCGAGATGCTACGCGGAAAGGCGGGCCTGGCTGCCGACATTTTCTCGCTC
GGGCTGATGACGCTCGAGGCTGCGGCCAACGTGGTGCTGCCCGACAACGGGCCTACGTGGATCGCGTTGCGGTCC
GGCGACCTTTCCGAAGTGCCGAGCCTGACGTGGACGCCTTCGATCGAGGTTGAGCGCGACGCCACGGGCAAGCCT
TCGAGCCACAGCAGCGACGAGCTCGACGGCGGCTCCCCGCCGCTGTTTGGGTCCTTTAAGCGGTCGGAGCTCCAG
CAGCCGCCGGACTTTATGGTCGAGGCCTTTCATCCGAGCTCGCTCGACTCGATTGTGCGGTGGATGACGGCCGAG
GCTCCGGCGGACAGACCGCTGGTGGATCAGGTGCTGGACCTCGAGGGCCTGCGGTGGGTGGCTGAGCACCGCAAC
GCGCCGGCGACGGTCTACGAAGGCAACTGGGGGCCGGTCGACGTGTTTCCCGTCTCCATCGCCGGCGACAGCGAC
ACGGAGATGACGGACGTGTGA
Transcript >Ophun1|2951
ATGTCCTTCTCCAACAGCGCCGGAGGCACCTTGGCACTGCCGTCGCCGACACACGCCCATCACATGGACGTGACG
TCGGCCGTCCGCAGTCTACGTCGATCCATCTCAAAGTCGCCCTCAAAGCTCCTGACGCGTACCGCCTCGCAGAGC
TCCTCCGAAAGCTCCCGCCAGGCCTCTTCGCCCCAGTCGCCCTGCCGCAGACGCTTCGGCTCGACGCCCTCGCGC
CCGTCGCTGTCGCCTTCGCACCCTCATACGGCCCCGCCGGCCTTCACCTCGTCACACGCCACCAACCCGTTATCT
ACCTTTACGCCGCTGCGCCCCAGCGTCAGGCTGTCGCTGCGCTCGACCAAGTCGGCCAAGACATCGTCGCCGTCA
CGACCCCTTGCGCGCGCCCGTGTCTCGCCCAAGAGCCCCCTGAAGCGAGCCCTCAACGACATCCCCGACTCGGGC
AACGCCCTCCACCCGGCCTCGCCCTCGTGCTCGCCCTCGCCAGGCCAGGAGAACGGCAGGGGCTCGTCGTCGACG
CCGCGCAGGCACCTCGACAAGCCAGCCCGTCACAGCGTCCACCTCGATGTGTCGGGCGCCGCCTCGCAATACTCA
TTCCTCAAAGCTCTCGACACGGCCGAGTCCTACATGGTGTCGACCACGGGCGCGCTGAAGCGCAGTGATGCCACC
ATGAACCTCGATCACCCCAACCAAGGGAGCCCCGTCGCCAAGCGCCGCAGCCTGCACGGTATCTCGGGCATCGGC
CAGGCCCAGGACCTCGACGACGTCCTCTGCGGTAATACCGACGCCACGCAACACTTTGAAATCCACGAGGACTCG
CCCTCGGACGAGTACGAGCTGACGGGCTCGCCTGACGCTGACCAAGCGGACGCGCCTCCCTCGCCTGTCCGTCGC
GACCCGTCGGCCTCGCCGTCTCCCGCCTCGTCCAACATGCCCAAGCGGTCCTCGTCGCTCCGCCGTTCGACGCTC
CAGCAGCGGCACGGGGACAAGGGCTCACTGGGCAGGAGGAACGGCGAGCGCCAGCTGGCCCAGATGACGCCCGAG
ACGTCGACGCCGCTACGGCACCGCCCCCGCCTGTCGACGGACCACTTCCTGCCCCCCTTGGGCAACCGAGAATGC
CTCTTCTCGACGGCGCCCTCCCTGTATCCATCCATTCACCAGGCCGAGGCCAAGGGTCCGCATCCGCTCTCCAGG
ACCTTGACAACATCGACGTCGGGCAACAGCCTCGACGAAGAGGAGTGCAAGGGCACGGCGGTCCCCGTCGCCCCT
ACCGCTGTCAAGGCGCCGGAGAAGCCCAAACCGCACCCCTTCTCTCGCTCTCTCCCTCTCAACGCCACCAGGCCC
GCCCCGGCCGCCGTCCGCCCCGCCAACGAGCACGTCAAGGGGATCGCGACGCCGAACCAGTCTCAGCTATGGATC
GGCGCCTTTCACTCCACCGGCCTCGTCTCAAAGGTCAACCGGAACCCCGAGGAGGAGGCCGAGAAGAAGCTCGCG
CCTCCCGATACGCCGTGCAAGAAGCACGCCAACCCGTTCGCCACCTTTCCGCCCCCGGCGGCTGGCAGCGCCATC
AAGAGAAAGAATCACAACCGCAACTCGTTCGCCGGCGTGCCCTCTACGCCCTTTAGCCGCTCCTCGGGCAGGGGA
GCCGAGACGTTTGGCGGCGCTCCGGGGAAGGGGCTTTCCATCTTCCAGCGCGGGTCGGCCGCTCATCACTCGCGC
CGCGGCAGCGTCCTCGGTCTCGACACCGAACCCGAGGACCGCATGCTCTTCGGCGAGGCCCCCGAGCTCTTCAGC
AACCTGATGGACGGCGACGCGCCGCCCACGCCGACCAAGAACGCCCTCACGCCCAGTCTCAGCAACCTCAGCGAA
CAGTCGCTGGAAAGCCCGAGCGCTAACCGCACCTTTTCCCTGCCGCTGTCGGCCATCAAGCCCGCTGCCGCCTGG
CGCGAGTCGTTGGCGGCCAAGTCGAAGCCGGACGCGTCGGCGCAGTCCAAGGAGCGCGACGATGACGCCATGGCT
CACGGCGGCGTCGGCCGAGCCGCCGTCACTACGACGGCTCAGGATCGCCAGCCGTCGCCCACGCCGTGCCTCGCG
CCGCGGTCTTCGTTTGGCAGGTCGAGGTTCGTCAAGGGGCTCAACGCGCCGTCGCCCCTGGCAGCTCCCCAGTCT
CCGCATCTGGTGATTCCGCGCTCGGAGAATGGATTCGCCAAGTTCACCTCGGTCGAACCGCCGACGGACGGGCGG
AGGACGCCGCAGACGCCTCAGGAGACGCTGCTCCCGCTCGACACGAGCCGGCTGTCCATCTCGCAGGCGCCAGAG
GGCTTGGGCGAGAACAGCATGCCGCCACCCGTGACGCCCACGGCCGGGCGCGACTTTCGGTCCTCGACTTGCAGC
TTCGTGACGCCCGTCAACGGCCGGACGAGCAACCTCGACGTCGACACCAGCCTCTCGTCGCGGTTCGACAAGGTC
GAGCAGGTGGGCAAGGGCGAGTTCTCGACTGTCTACCGCGTCAGCCGGCTGGAGCCCGCCAACGGCGACGTGACG
CCCGGCGAGGACGCGTCGGCGCTCAGTCCCGCGCACGGCCAGCAGGTCTTTGCGGTCAAGAAGAGCAAGCACTCG
TACCACGGGCCCAAGGATCGCGAACTCAAGCTCCGCGAGGTGGGCATCCTCCAGGCGCTGACGCACGCCGAGCAT
GTTGTGCAATATGTCGACAGCTGGGAACACAATTTCCATTTGTATATACAGACGGAGTTCTGCGAGGAGGGGACC
CTGGACAGATTTTTGGGCAATGTCGGACGAGGCGGGAGGTTGGATGACTTCCGCATCTTCAAGATCTTGCAGGAT
CTCAGCCTGGGTCTCAAGGAGATTCACGACGCCGGGTTTATGCACCTGGACATGAAGCCGGCCAACATCCTCATC
AGCTTCGAGGGCGCGCTCAAGATTGGCGACTTTGGGCTGGCCCAGCCGTGCTCGTCGGCCGAGGGCGTCGACGTC
GAGGGCGATCGCGAATACATGGCGCCCGAGATGCTACGCGGAAAGGCGGGCCTGGCTGCCGACATTTTCTCGCTC
GGGCTGATGACGCTCGAGGCTGCGGCCAACGTGGTGCTGCCCGACAACGGGCCTACGTGGATCGCGTTGCGGTCC
GGCGACCTTTCCGAAGTGCCGAGCCTGACGTGGACGCCTTCGATCGAGGTTGAGCGCGACGCCACGGGCAAGCCT
TCGAGCCACAGCAGCGACGAGCTCGACGGCGGCTCCCCGCCGCTGTTTGGGTCCTTTAAGCGGTCGGAGCTCCAG
CAGCCGCCGGACTTTATGGTCGAGGCCTTTCATCCGAGCTCGCTCGACTCGATTGTGCGGTGGATGACGGCCGAG
GCTCCGGCGGACAGACCGCTGGTGGATCAGGTGCTGGACCTCGAGGGCCTGCGGTGGGTGGCTGAGCACCGCAAC
GCGCCGGCGACGGTCTACGAAGGCAACTGGGGGCCGGTCGACGTGTTTCCCGTCTCCATCGCCGGCGACAGCGAC
ACGGAGATGACGGACGTGTGA
Gene >Ophun1|2951
ATGTCCTTCTCCAACAGCGCCGGAGGCACCTTGGCACTGCCGTCGCCGACACACGCCCATCACATGGACGTGACG
TCGGCCGTCCGCAGTCTACGTCGATCCATCTCAAAGTCGCCCTCAAAGCTCCTGACGCGTACCGCCTCGCAGAGC
TCCTCCGAAAGCTCCCGCCAGGCCTCTTCGCCCCAGTCGCCCTGCCGCAGACGCTTCGGCTCGACGCCCTCGCGC
CCGTCGCTGTCGCCTTCGCACCCTCATACGGCCCCGCCGGCCTTCACCTCGTCACACGCCACCAACCCGTTATCT
ACCTTTACGCCGCTGCGCCCCAGCGTCAGGCTGTCGCTGCGCTCGACCAAGTCGGCCAAGACATCGTCGCCGTCA
CGACCCCTTGCGCGCGCCCGTGTCTCGCCCAAGAGCCCCCTGAAGCGAGCCCTCAACGACATCCCCGACTCGGGC
AACGCCCTCCACCCGGCCTCGCCCTCGTGCTCGCCCTCGCCAGGCCAGGAGAACGGCAGGGGCTCGTCGTCGACG
CCGCGCAGGCACCTCGACAAGCCAGCCCGTCACAGCGTCCACCTCGATGTGTCGGGCGCCGCCTCGCAATACTCA
TTCCTCAAAGCTCTCGACACGGCCGAGTCCTACATGGTGTCGACCACGGGCGCGCTGAAGCGCAGTGATGCCACC
ATGAACCTCGATCACCCCAACCAAGGGAGCCCCGTCGCCAAGCGCCGCAGCCTGCACGGTATCTCGGGCATCGGC
CAGGCCCAGGACCTCGACGACGTCCTCTGCGGTAATACCGACGCCACGCAACACTTTGAAATCCACGAGGACTCG
CCCTCGGACGAGTACGAGCTGACGGGCTCGCCTGACGCTGACCAAGCGGACGCGCCTCCCTCGCCTGTCCGTCGC
GACCCGTCGGCCTCGCCGTCTCCCGCCTCGTCCAACATGCCCAAGCGGTCCTCGTCGCTCCGCCGTTCGACGCTC
CAGCAGCGGCACGGGGACAAGGGCTCACTGGGCAGGAGGAACGGCGAGCGCCAGCTGGCCCAGATGACGCCCGAG
ACGTCGACGCCGCTACGGCACCGCCCCCGCCTGTCGACGGACCACTTCCTGCCCCCCTTGGGCAACCGAGAATGC
CTCTTCTCGACGGCGCCCTCCCTGTATCCATCCATTCACCAGGCCGAGGCCAAGGGTCCGCATCCGCTCTCCAGG
ACCTTGACAACATCGACGTCGGGCAACAGCCTCGACGAAGAGGAGTGCAAGGGCACGGCGGTCCCCGTCGCCCCT
ACCGCTGTCAAGGCGCCGGAGAAGCCCAAACCGCACCCCTTCTCTCGCTCTCTCCCTCTCAACGCCACCAGGCCC
GCCCCGGCCGCCGTCCGCCCCGCCAACGAGCACGTCAAGGGGATCGCGACGCCGAACCAGTCTCAGCTATGGATC
GGCGCCTTTCACTCCACCGGCCTCGTCTCAAAGGTCAACCGGAACCCCGAGGAGGAGGCCGAGAAGAAGCTCGCG
CCTCCCGATACGCCGTGCAAGAAGCACGCCAACCCGTTCGCCACCTTTCCGCCCCCGGCGGCTGGCAGCGCCATC
AAGAGAAAGAATCACAACCGCAACTCGTTCGCCGGCGTGCCCTCTACGCCCTTTAGCCGCTCCTCGGGCAGGGGA
GCCGAGACGTTTGGCGGCGCTCCGGGGAAGGGGCTTTCCATCTTCCAGCGCGGGTCGGCCGCTCATCACTCGCGC
CGCGGCAGCGTCCTCGGTCTCGACACCGAACCCGAGGACCGCATGCTCTTCGGCGAGGCCCCCGAGCTCTTCAGC
AACCTGATGGACGGCGACGCGCCGCCCACGCCGACCAAGAACGCCCTCACGCCCAGTCTCAGCAACCTCAGCGAA
CAGTCGCTGGAAAGCCCGAGCGCTAACCGCACCTTTTCCCTGCCGCTGTCGGCCATCAAGCCCGCTGCCGCCTGG
CGCGAGTCGTTGGCGGCCAAGTCGAAGCCGGACGCGTCGGCGCAGTCCAAGGAGCGCGACGATGACGCCATGGCT
CACGGCGGCGTCGGCCGAGCCGCCGTCACTACGACGGCTCAGGATCGCCAGCCGTCGCCCACGCCGTGCCTCGCG
CCGCGGTCTTCGTTTGGCAGGTCGAGGTTCGTCAAGGGGCTCAACGCGCCGTCGCCCCTGGCAGCTCCCCAGTCT
CCGCATCTGGTGATTCCGCGCTCGGAGAATGGATTCGCCAAGTTCACCTCGGTCGAACCGCCGACGGACGGGCGG
AGGACGCCGCAGACGCCTCAGGAGACGCTGCTCCCGCTCGACACGAGCCGGCTGTCCATCTCGCAGGCGCCAGAG
GGCTTGGGCGAGAACAGCATGCCGCCACCCGTGACGCCCACGGCCGGGCGCGACTTTCGGTCCTCGACTTGCAGC
TTCGTGACGCCCGTCAACGGCCGGACGAGCAACCTCGACGTCGACACCAGCCTCTCGTCGCGGTTCGACAAGGTC
GAGCAGGTGGGCAAGGGCGAGTTCTCGACTGTCTACCGCGTCAGCCGGCTGGAGCCCGCCAACGGCGACGTGACG
CCCGGCGAGGACGCGTCGGCGCTCAGTCCCGCGCACGGCCAGCAGGTCTTTGCGGTCAAGAAGAGCAAGCACTCG
TACCACGGGCCCAAGGATCGCGAACTCAAGCTCCGCGAGGTGGGCATCCTCCAGGCGCTGACGCACGCCGAGCAT
GTTGTGCAATATGTCGACAGCTGGGAACACAATTTCCATTTGTATATACAGACGGAGTTCTGCGAGGAGGGGACC
CTGGACAGATTTTTGGGCAATGTCGGACGAGGCGGGAGGTTGGATGACTTCCGCATCTTCAAGATCTTGCAGGAT
CTCAGCCTGGTGAGTGACGAGAGCAGCGCGCGTGTGTGGGAGTTGAGAAGAGATGCTGACTTGCGAGGAATAGGG
TCTCAAGGAGATTCACGACGCCGGGTTTATGCACCTGGACATGAAGCCGGCCAACATCCTCATCAGCTTCGAGGG
CGCGCTCAAGATTGGCGACTTTGGGCTGGCCCAGCCGTGCTCGTCGGCCGAGGGCGTCGACGTCGAGGGCGATCG
CGAATACATGGCGCCCGAGATGCTACGCGGAAAGGCGGGCCTGGCTGCCGACATTTTCTCGCTCGGGCTGATGAC
GCTCGAGGCTGCGGCCAACGTGGTGCTGCCCGACAACGGGCCTACGTGGATCGCGTTGCGGTCCGGCGACCTTTC
CGAAGTGCCGAGCCTGACGTGGACGCCTTCGATCGAGGTTGAGCGCGACGCCACGGGCAAGCCTTCGAGCCACAG
CAGCGACGAGCTCGACGGCGGCTCCCCGCCGCTGTTTGGGTCCTTTAAGCGGTCGGAGCTCCAGCAGCCGCCGGA
CTTTATGGTCGAGGCCTTTCATCCGAGCTCGCTCGACTCGATTGTGCGGTGGATGACGGCCGAGGCTCCGGCGGA
CAGACCGCTGGTGGATCAGGTGCTGGACCTCGAGGGCCTGCGGTGGGTGGCTGAGCACCGCAACGCGCCGGCGAC
GGTCTACGAAGGCAACTGGGGGCCGGTCGACGTGTTTCCCGTCTCCATCGCCGGCGACAGCGACACGGAGATGAC
GGACGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail