Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2940
Gene name
LocationContig_260:12300..13762
Strand-
Gene length (bp)1462
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 7.2E-16 80 381
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.3E-07 112 214

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12405|LPX1_YEAST Peroxisomal membrane protein LPX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPX1 PE=1 SV=1 77 337 6.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2940
MVPALTARLASRSRRAGLCSRFTRMSSTVFHQLQHTVNAAHTREYVGATADGDDDRPLLSVKQYVPLDNPHPQPG
DVTIIGAHANGFSKELYEPLWDEVYQQLARRCIRLRSVWIADMWNQGQSGVLNEKMLGNDPSWFDHARDLMNLIN
AKFDDIRHPIIGIGHSMGATQLALLSLSHPRLFDALVLIDPVIDVGTGALSPAVLSSNRRDIWPSRKAAAEKFDE
SAFYKTWDARVLQRWKEYGLRPVPTEIHPAHGECDERVTLTTSKHQEVFTFLRPMYRGETMVDLDPEQKDKMTGY
PFYRPEPAYVFKRLPELRPSTLYVFGARSDLSTPEMQEEKMATTGVGIGGSGGGAVGRVRQVVLDCGHLVAMEKV
DECAEAITEFLDTELARQRREAELQKQDSEEKPRQKRMMMDERWMKEINGSSSRQPKL*
Coding >Ophun1|2940
ATGGTGCCCGCGCTGACGGCCCGCCTCGCATCGCGGAGTCGCCGCGCAGGTCTCTGCAGCCGCTTCACGAGGATG
TCGTCCACCGTCTTCCACCAGCTGCAGCATACGGTCAACGCGGCGCACACGCGCGAGTACGTGGGCGCCACAGCC
GACGGCGATGACGATAGGCCTCTGCTCAGTGTCAAGCAGTACGTGCCGCTGGACAACCCTCATCCGCAGCCGGGC
GACGTTACCATCATCGGCGCGCACGCCAATGGCTTCTCCAAGGAGCTGTACGAGCCGCTCTGGGACGAAGTCTAC
CAGCAGCTGGCCCGTCGTTGCATTCGTCTCCGCTCTGTTTGGATCGCCGACATGTGGAATCAGGGCCAATCCGGT
GTGCTCAACGAGAAGATGCTGGGCAACGACCCGAGCTGGTTCGATCATGCGCGAGATCTCATGAACCTCATCAAC
GCCAAGTTCGACGACATCCGCCATCCCATCATCGGCATCGGCCATAGCATGGGAGCCACTCAGCTAGCATTGCTA
TCTCTCTCTCATCCACGGCTCTTTGACGCCCTGGTCTTGATCGATCCTGTCATCGACGTCGGCACCGGAGCCCTC
TCGCCCGCCGTCCTCTCATCCAATCGACGCGATATCTGGCCTTCAAGAAAGGCTGCGGCCGAAAAGTTCGACGAG
AGCGCCTTTTACAAGACTTGGGACGCGCGAGTGCTCCAGCGCTGGAAGGAGTACGGCCTGCGACCGGTGCCGACG
GAGATTCACCCTGCGCACGGCGAATGCGACGAGCGCGTCACGCTCACTACGTCCAAACACCAGGAGGTCTTTACC
TTTCTCAGGCCCATGTATCGCGGCGAGACGATGGTGGACCTGGATCCGGAGCAGAAGGATAAGATGACCGGATAT
CCCTTCTACCGGCCCGAGCCGGCGTACGTCTTCAAGCGTCTCCCGGAGTTGCGTCCCAGCACGCTGTACGTCTTT
GGCGCCCGCTCGGACTTGTCGACGCCGGAGATGCAAGAGGAGAAGATGGCAACGACGGGTGTCGGCATAGGCGGC
AGCGGTGGCGGCGCCGTGGGACGCGTGAGGCAGGTCGTCCTCGATTGCGGCCATCTGGTGGCCATGGAGAAAGTC
GACGAGTGCGCCGAGGCTATTACCGAGTTTCTCGACACCGAGCTGGCCAGGCAGCGGCGCGAGGCGGAATTGCAG
AAGCAGGATTCGGAGGAGAAGCCGAGACAGAAGCGGATGATGATGGATGAGCGGTGGATGAAGGAGATTAACGGC
TCGAGTAGCCGCCAGCCTAAGCTGTGA
Transcript >Ophun1|2940
ATGGTGCCCGCGCTGACGGCCCGCCTCGCATCGCGGAGTCGCCGCGCAGGTCTCTGCAGCCGCTTCACGAGGATG
TCGTCCACCGTCTTCCACCAGCTGCAGCATACGGTCAACGCGGCGCACACGCGCGAGTACGTGGGCGCCACAGCC
GACGGCGATGACGATAGGCCTCTGCTCAGTGTCAAGCAGTACGTGCCGCTGGACAACCCTCATCCGCAGCCGGGC
GACGTTACCATCATCGGCGCGCACGCCAATGGCTTCTCCAAGGAGCTGTACGAGCCGCTCTGGGACGAAGTCTAC
CAGCAGCTGGCCCGTCGTTGCATTCGTCTCCGCTCTGTTTGGATCGCCGACATGTGGAATCAGGGCCAATCCGGT
GTGCTCAACGAGAAGATGCTGGGCAACGACCCGAGCTGGTTCGATCATGCGCGAGATCTCATGAACCTCATCAAC
GCCAAGTTCGACGACATCCGCCATCCCATCATCGGCATCGGCCATAGCATGGGAGCCACTCAGCTAGCATTGCTA
TCTCTCTCTCATCCACGGCTCTTTGACGCCCTGGTCTTGATCGATCCTGTCATCGACGTCGGCACCGGAGCCCTC
TCGCCCGCCGTCCTCTCATCCAATCGACGCGATATCTGGCCTTCAAGAAAGGCTGCGGCCGAAAAGTTCGACGAG
AGCGCCTTTTACAAGACTTGGGACGCGCGAGTGCTCCAGCGCTGGAAGGAGTACGGCCTGCGACCGGTGCCGACG
GAGATTCACCCTGCGCACGGCGAATGCGACGAGCGCGTCACGCTCACTACGTCCAAACACCAGGAGGTCTTTACC
TTTCTCAGGCCCATGTATCGCGGCGAGACGATGGTGGACCTGGATCCGGAGCAGAAGGATAAGATGACCGGATAT
CCCTTCTACCGGCCCGAGCCGGCGTACGTCTTCAAGCGTCTCCCGGAGTTGCGTCCCAGCACGCTGTACGTCTTT
GGCGCCCGCTCGGACTTGTCGACGCCGGAGATGCAAGAGGAGAAGATGGCAACGACGGGTGTCGGCATAGGCGGC
AGCGGTGGCGGCGCCGTGGGACGCGTGAGGCAGGTCGTCCTCGATTGCGGCCATCTGGTGGCCATGGAGAAAGTC
GACGAGTGCGCCGAGGCTATTACCGAGTTTCTCGACACCGAGCTGGCCAGGCAGCGGCGCGAGGCGGAATTGCAG
AAGCAGGATTCGGAGGAGAAGCCGAGACAGAAGCGGATGATGATGGATGAGCGGTGGATGAAGGAGATTAACGGC
TCGAGTAGCCGCCAGCCTAAGCTGTGA
Gene >Ophun1|2940
ATGGTGCCCGCGCTGACGGCCCGCCTCGCATCGCGGAGTCGCCGCGCAGGTCTCTGCAGCCGCTTCACGAGGATG
TCGTCCACCGTCTTCCACCAGCTGCAGCATACGGTCAACGCGGCGCACACGCGCGAGTACGTGGGCGCCACAGCC
GACGGCGATGACGATAGGCCTCTGCTCAGTGTCAAGCAGTACGTGCCGCTGGACAACCCTCATCCGCAGCCGGGC
GACGTTACCATCATCGGCGCGCACGCCAATGGCTTCTCCAAGGTGATGATGAACGAATCAACTCTCTTGGGGAGC
TTTCCTGACCTTGTTTCGTGATGCAGGAGCTGTACGAGCCGCTCTGGGACGAAGTCTACCAGCAGCTGGCCCGTC
GTTGCATTCGTCTCCGCTCTGTTTGGATCGCCGACATGTGGAATCAGGGCCAATCCGGTGTGCTCAACGAGAAGA
TGCTGGGCAACGACCGTAAGCGCCTGGTCCTTGATAAAACTTTCTTTTACTGACTTTTTCTGGCAGCGAGCTGGT
TCGATCATGCGCGAGATCTCATGAACCTCATCAACGCCAAGTTCGACGACATCCGCCATCCCATCATCGGCATCG
GCCATAGCATGGGAGCCACTCAGCTGTAGGTTGACCAATCTCAATAATCATACGCACCTGCTCACGCGCTCCAAG
AGCATTGCTATCTCTCTCTCATCCACGGCTCTTTGACGCCCTGGTCTTGATCGATCCTGTCATCGACGTCGGCAC
CGGAGCCCTCTCGCCCGCCGTCCTCTCATCCAATCGACGCGATATCTGGCCTTCAAGAAAGGCTGCGGCCGAAAA
GTTCGACGAGAGCGCCTTTTACAAGACTTGGGACGCGCGAGTGCTCCAGCGCTGGAAGGAGTACGGCCTGCGACC
GGTGCCGACGGAGATTCACCCTGCGCACGGCGAATGCGACGAGCGCGTCACGCTCACTACGTCCAAACACCAGGA
GGTCTTTACCTTTCTCAGGCCCATGTATCGCGGCGAGACGATGGTGGACCTGGATCCGGAGCAGAAGGATAAGAT
GACCGGATATCCCTTCTACCGGCCCGAGCCGGCGTACGTCTTCAAGCGTCTCCCGGAGTTGCGTCCCAGCACGCT
GTACGTCTTTGGCGCCCGCTCGGACTTGTCGACGCCGGAGATGCAAGAGGAGAAGATGGCAACGACGGGTGTCGG
CATAGGCGGCAGCGGTGGCGGCGCCGTGGGACGCGTGAGGCAGGTCGTCCTCGATTGCGGCCATCTGGTGGCCAT
GGAGAAAGTCGACGAGTGCGCCGAGGCTATTACCGAGTTTCTCGACACCGAGCTGGCCAGGCAGCGGCGCGAGGC
GGAATTGCAGAAGCAGGATTCGGAGGAGAAGCCGAGACAGAAGCGGATGATGATGGATGAGCGGTGGATGAAGGA
GATTAACGGCTCGAGTAGCCGCCAGCCTAAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail