Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2938
Gene name
LocationContig_260:8305..9964
Strand+
Gene length (bp)1659
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup121
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1029
Ophiocordyceps australis map64 (Brazil) OphauB2|161
Ophiocordyceps camponoti-floridani Ophcf2|02222
Ophiocordyceps camponoti-rufipedis Ophun1|2938 (this protein)
Ophiocordyceps kimflemingae Ophio5|3458
Ophiocordyceps subramaniannii Hirsu2|10002
Ophiocordyceps subramaniannii Hirsu2|23
Ophiocordyceps subramaniannii Hirsu2|431
Ophiocordyceps subramaniannii Hirsu2|4496
Ophiocordyceps subramaniannii Hirsu2|5356
Ophiocordyceps subramaniannii Hirsu2|8076

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2938
MLHPLLPLILTANAALGSMITHDHPVAQNFLSTLLENINLDWTTPPTSETNHISEKSCGMSIFKCARTLFKTKKT
LVKRYPPLPGGWQMVDYRPNITAYFIPRLERGIMNLGDDDISFAADESTSTVDSATKGWQIGAQISGSLGLSVSA
SFSKSQSAGTSQTKGVSIQTTCRAGYDCRIETWTYHLRIEGYCQLRPIIDCDGEINPCQSMTGLMCDQYYDFRQR
HCLTCSSASPFFHEKCQVQTPILDPAGRPFSRLVRISEKMSEWSDKGSDGQQPPEKAIKFEEGLYQLESGEWYDD
TDQTYYGNLDDNWYHKPGFPNPDLSLGAAVRRVCKTLPCHREFAQLVGSRKLIPAECERHRKVPELTYRVEDIFF
PSTPTCGRTTSKLRLQPSDFSSVCNCVMEKRYGDGDACPDCKMSSCYRELIHMYGGSVDMLKRQCQHGELSKAEP
RFYDLPSFPFDSYCGQVVQYFHFKVDDFKSVCECVETNHALHQAKGSGSQGRHKTEASRSRTSRFKRQALDESKM
PSRSQKKKTIWKGGAEVEIEFLDEAPI*
Coding >Ophun1|2938
ATGCTCCACCCTCTTCTCCCCCTAATCCTCACAGCCAACGCCGCCCTCGGCAGTATGATCACCCACGACCACCCC
GTAGCCCAAAACTTCCTCTCCACGCTCCTCGAAAACATCAATCTCGACTGGACCACACCCCCAACCAGCGAAACA
AACCATATAAGCGAAAAGTCATGCGGCATGTCCATCTTCAAATGCGCCAGGACGCTGTTCAAGACCAAGAAGACG
CTGGTCAAGAGGTATCCTCCCCTTCCCGGCGGCTGGCAGATGGTCGACTACCGGCCCAACATCACCGCCTACTTC
ATCCCACGCCTGGAGAGAGGAATCATGAACCTGGGTGACGATGACATCTCTTTTGCTGCCGATGAGTCGACTTCG
ACCGTCGATAGCGCCACTAAGGGCTGGCAGATTGGCGCCCAGATCTCCGGCAGTCTCGGCCTCTCCGTCTCAGCC
AGCTTCTCCAAGAGCCAGAGCGCAGGAACCAGCCAGACAAAGGGCGTGTCGATACAAACAACCTGCCGCGCTGGA
TATGACTGCCGTATCGAGACGTGGACGTATCACCTCCGCATCGAGGGATACTGCCAGCTGCGGCCCATCATCGAC
TGCGATGGCGAGATCAACCCGTGTCAGTCCATGACGGGTCTCATGTGCGATCAGTACTACGACTTTCGGCAGCGT
CACTGTCTCACCTGCAGCTCAGCCTCGCCCTTTTTCCACGAAAAGTGCCAGGTGCAGACTCCCATCCTCGATCCA
GCCGGCCGGCCCTTTTCACGCCTCGTCCGTATCTCGGAGAAGATGTCGGAGTGGTCAGACAAAGGGTCAGATGGT
CAGCAGCCGCCCGAAAAGGCCATCAAGTTCGAAGAAGGCCTGTACCAGCTCGAAAGCGGCGAGTGGTACGACGAC
ACGGACCAAACCTACTACGGAAACCTCGACGACAACTGGTATCACAAGCCCGGTTTCCCCAACCCGGATCTCTCG
CTCGGGGCCGCCGTCCGGCGCGTCTGCAAGACTCTTCCGTGTCACCGCGAGTTCGCACAACTGGTGGGAAGCAGG
AAACTCATTCCAGCAGAATGCGAGCGTCACCGGAAAGTGCCGGAACTGACGTATCGCGTCGAGGACATCTTCTTC
CCCTCGACTCCCACCTGCGGGCGGACGACGTCGAAGCTCCGGCTGCAGCCTTCTGACTTTTCGAGCGTGTGCAAC
TGCGTGATGGAGAAGAGATATGGCGACGGTGATGCTTGCCCGGACTGCAAGATGTCGAGCTGCTATCGAGAGCTC
ATCCACATGTACGGCGGCTCCGTCGACATGCTCAAGAGGCAGTGTCAGCACGGAGAACTAAGCAAAGCAGAGCCG
AGATTCTATGATCTTCCCAGCTTTCCATTCGACTCCTACTGCGGTCAAGTTGTGCAATACTTTCACTTCAAGGTG
GACGACTTCAAGTCCGTATGCGAATGCGTCGAGACCAATCACGCTCTCCATCAGGCCAAGGGCTCTGGCTCTCAG
GGCAGACACAAAACCGAGGCCTCTCGCTCTCGGACCAGCCGATTCAAGCGGCAAGCCTTGGACGAATCGAAGATG
CCGTCTCGGTCACAGAAGAAGAAGACGATATGGAAGGGGGGAGCTGAAGTCGAGATTGAGTTTCTGGACGAGGCG
CCCATTTGA
Transcript >Ophun1|2938
ATGCTCCACCCTCTTCTCCCCCTAATCCTCACAGCCAACGCCGCCCTCGGCAGTATGATCACCCACGACCACCCC
GTAGCCCAAAACTTCCTCTCCACGCTCCTCGAAAACATCAATCTCGACTGGACCACACCCCCAACCAGCGAAACA
AACCATATAAGCGAAAAGTCATGCGGCATGTCCATCTTCAAATGCGCCAGGACGCTGTTCAAGACCAAGAAGACG
CTGGTCAAGAGGTATCCTCCCCTTCCCGGCGGCTGGCAGATGGTCGACTACCGGCCCAACATCACCGCCTACTTC
ATCCCACGCCTGGAGAGAGGAATCATGAACCTGGGTGACGATGACATCTCTTTTGCTGCCGATGAGTCGACTTCG
ACCGTCGATAGCGCCACTAAGGGCTGGCAGATTGGCGCCCAGATCTCCGGCAGTCTCGGCCTCTCCGTCTCAGCC
AGCTTCTCCAAGAGCCAGAGCGCAGGAACCAGCCAGACAAAGGGCGTGTCGATACAAACAACCTGCCGCGCTGGA
TATGACTGCCGTATCGAGACGTGGACGTATCACCTCCGCATCGAGGGATACTGCCAGCTGCGGCCCATCATCGAC
TGCGATGGCGAGATCAACCCGTGTCAGTCCATGACGGGTCTCATGTGCGATCAGTACTACGACTTTCGGCAGCGT
CACTGTCTCACCTGCAGCTCAGCCTCGCCCTTTTTCCACGAAAAGTGCCAGGTGCAGACTCCCATCCTCGATCCA
GCCGGCCGGCCCTTTTCACGCCTCGTCCGTATCTCGGAGAAGATGTCGGAGTGGTCAGACAAAGGGTCAGATGGT
CAGCAGCCGCCCGAAAAGGCCATCAAGTTCGAAGAAGGCCTGTACCAGCTCGAAAGCGGCGAGTGGTACGACGAC
ACGGACCAAACCTACTACGGAAACCTCGACGACAACTGGTATCACAAGCCCGGTTTCCCCAACCCGGATCTCTCG
CTCGGGGCCGCCGTCCGGCGCGTCTGCAAGACTCTTCCGTGTCACCGCGAGTTCGCACAACTGGTGGGAAGCAGG
AAACTCATTCCAGCAGAATGCGAGCGTCACCGGAAAGTGCCGGAACTGACGTATCGCGTCGAGGACATCTTCTTC
CCCTCGACTCCCACCTGCGGGCGGACGACGTCGAAGCTCCGGCTGCAGCCTTCTGACTTTTCGAGCGTGTGCAAC
TGCGTGATGGAGAAGAGATATGGCGACGGTGATGCTTGCCCGGACTGCAAGATGTCGAGCTGCTATCGAGAGCTC
ATCCACATGTACGGCGGCTCCGTCGACATGCTCAAGAGGCAGTGTCAGCACGGAGAACTAAGCAAAGCAGAGCCG
AGATTCTATGATCTTCCCAGCTTTCCATTCGACTCCTACTGCGGTCAAGTTGTGCAATACTTTCACTTCAAGGTG
GACGACTTCAAGTCCGTATGCGAATGCGTCGAGACCAATCACGCTCTCCATCAGGCCAAGGGCTCTGGCTCTCAG
GGCAGACACAAAACCGAGGCCTCTCGCTCTCGGACCAGCCGATTCAAGCGGCAAGCCTTGGACGAATCGAAGATG
CCGTCTCGGTCACAGAAGAAGAAGACGATATGGAAGGGGGGAGCTGAAGTCGAGATTGAGTTTCTGGACGAGGCG
CCCATTTGA
Gene >Ophun1|2938
ATGCTCCACCCTCTTCTCCCCCTAATCCTCACAGCCAACGCCGCCCTCGGCAGTATGATCACCCACGACCACCCC
GTAGCCCAAAACTTCCTCTCCACGCTCCTCGAAAACATCAATCTCGACTGGACCACACCCCCAACCAGCGAAACA
AACCATATAAGCGAAAAGTCATGCGGCATGTCCATCTTCAAATGCGCCAGGACGCTGTTCAAGACCAAGAAGACG
CTGGTCAAGAGGTATCCTCCCCTTCCCGGCGGCTGGCAGATGGTCGACTACCGGCCCAACATCACCGCCTACTTC
ATCCCACGCCTGGAGAGAGGAATCATGAACCTGGGTGACGATGACATCTCTTTTGCTGCCGATGAGTCGACTTCG
ACCGTCGATAGCGCCACTAAGGGCTGGCAGATTGGCGCCCAGATCTCCGGCAGTCTCGGCCTCTCCGTCTCAGCC
AGCTTCTCCAAGAGCCAGAGCGCAGGAACCAGCCAGACAAAGGGCGTGTCGATACAAACAACCTGCCGCGCTGGA
TATGACTGCCGTATCGAGACGTGGACGTATCACCTCCGCATCGAGGGATACTGCCAGCTGCGGCCCATCATCGAC
TGCGATGGCGAGATCAACCCGTGTCAGTCCATGACGGGTCTCATGTGCGATCAGTACTACGACTTTCGGCAGCGT
CACTGTCTCACCTGCAGCTCAGCCTCGCCCTTTTTCCACGAAAAGTGCCAGGTGCAGACTCCCATCCTCGATCCA
GCCGGCCGGCCCTTTTCACGCCTCGTCCGTATCTCGGAGAAGATGTCGGAGTGGTCAGACAAAGGGTCAGATGGT
CAGCAGCCGCCCGAAAAGGCCATCAAGTTCGAAGAAGGCCTGTACCAGCTCGAAAGCGGCGAGTGGTACGACGAC
ACGGACCAAACCTACTACGGAAACCTCGACGACAACTGGTATCACAAGCCCGGTTTCCCCAACCCGGATCTCTCG
CTCGGGGCCGCCGTCCGGCGCGTCTGCAAGACTCTTCCGTGTCACCGCGAGTTCGCACAACTGGTGGGAAGCAGG
AAACTCATTCCAGCAGAATGCGAGCGTCACCGGAAAGTGCCGGAACTGACGTATCGCGTCGAGGACATCTTCTTC
CCCTCGACTCCCACCTGCGGGCGGACGACGTCGAAGCTCCGGCTGCAGCCTTCTGACTTTTCGAGCGTGTGCAAC
TGCGTGATGGAGAAGAGATATGGCGACGGTGATGCTTGCCCGGACTGCAAGATGTCGAGCTGCTATCGAGAGCTC
ATCCACATGTACGGCGGCTCCGTCGACATGCTCAAGAGGCAGTGTCAGCACGGAGAACTAAGCAAAGCAGAGCCG
AGATTCTATGATCTTCCCAGCTTTCCATTCGACTCCTACTGCGGTCAAGTTGTGCAATACTTTCACTTCAAGGTG
GACGACTTCAAGTCCGTATGCGAATGCGTCGAGACCAATCACGCTCTCCATCAGGCCAAGGGCTCTGGCTCTCAG
GGCAGACACAAAACCGAGGCCTCTCGCTCTCGGACCAGCCGATTCAAGCGGCAAGCCTTGGACGAATCGAAGATG
CCGTCTCGGTCACAGAAGAAGAAGACGATATGGAAGGGGGGAGCTGAAGTCGAGATTGAGTTTCTGGACGAGGCG
CCCATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail