Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2934
Gene name
LocationContig_26:62842..63364
Strand-
Gene length (bp)522
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05832 DUF846 Eukaryotic protein of unknown function (DUF846) 3.0E-41 2 110

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RME3|TVP23_MAGO7 Golgi apparatus membrane protein TVP23 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TVP23 PE=3 SV=2 1 145 2.0E-80
sp|Q7SGB6|TVP23_NEUCR Golgi apparatus membrane protein tvp23 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tvp23 PE=3 SV=4 1 144 5.0E-78
sp|B2ALT5|TVP23_PODAN Golgi apparatus membrane protein TVP23 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=TVP23 PE=3 SV=1 1 144 9.0E-78
sp|A6SFL7|TVP23_BOTFB Golgi apparatus membrane protein tvp23 OS=Botryotinia fuckeliana (strain B05.10) GN=tvp23 PE=3 SV=1 1 144 2.0E-71
sp|Q0UV43|TVP23_PHANO Golgi apparatus membrane protein TVP23 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TVP23 PE=3 SV=3 1 140 1.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RME3|TVP23_MAGO7 Golgi apparatus membrane protein TVP23 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TVP23 PE=3 SV=2 1 145 2.0E-80
sp|Q7SGB6|TVP23_NEUCR Golgi apparatus membrane protein tvp23 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tvp23 PE=3 SV=4 1 144 5.0E-78
sp|B2ALT5|TVP23_PODAN Golgi apparatus membrane protein TVP23 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=TVP23 PE=3 SV=1 1 144 9.0E-78
sp|A6SFL7|TVP23_BOTFB Golgi apparatus membrane protein tvp23 OS=Botryotinia fuckeliana (strain B05.10) GN=tvp23 PE=3 SV=1 1 144 2.0E-71
sp|Q0UV43|TVP23_PHANO Golgi apparatus membrane protein TVP23 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TVP23 PE=3 SV=3 1 140 1.0E-61
sp|Q0CSZ7|TVP23_ASPTN Golgi apparatus membrane protein tvp23 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tvp23 PE=3 SV=2 1 143 1.0E-60
sp|Q2UUK2|TVP23_ASPOR Golgi apparatus membrane protein tvp23 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tvp23 PE=3 SV=1 1 143 7.0E-60
sp|A2Q9P5|TVP23_ASPNC Golgi apparatus membrane protein tvp23 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tvp23 PE=3 SV=1 1 144 1.0E-57
sp|Q1E9X9|TVP23_COCIM Golgi apparatus membrane protein TVP23 OS=Coccidioides immitis (strain RS) GN=TVP23 PE=3 SV=1 1 142 2.0E-57
sp|B0Y4Q8|TVP23_ASPFC Golgi apparatus membrane protein tvp23 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tvp23 PE=3 SV=1 1 143 2.0E-56
sp|Q4WQJ5|TVP23_ASPFU Golgi apparatus membrane protein tvp23 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tvp23 PE=3 SV=1 1 143 2.0E-56
sp|A1CW41|TVP23_NEOFI Golgi apparatus membrane protein tvp23 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tvp23 PE=3 SV=1 1 143 2.0E-56
sp|A1CIM7|TVP23_ASPCL Golgi apparatus membrane protein tvp23 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tvp23 PE=3 SV=1 1 144 2.0E-54
sp|Q6C7V5|TVP23_YARLI Golgi apparatus membrane protein TVP23 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TVP23 PE=3 SV=1 11 125 1.0E-37
sp|Q5APA2|TVP23_CANAL Golgi apparatus membrane protein TVP23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TVP23 PE=3 SV=1 3 140 7.0E-36
sp|Q9Y7K7|TVP23_SCHPO Golgi apparatus membrane protein tvp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tvp23 PE=3 SV=1 1 134 4.0E-33
sp|Q6BVH1|TVP23_DEBHA Golgi apparatus membrane protein TVP23 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TVP23 PE=3 SV=1 3 144 2.0E-31
sp|Q54LC9|TV23B_DICDI Uncharacterized Golgi apparatus membrane protein-like protein 2 OS=Dictyostelium discoideum GN=DDB_G0286703 PE=3 SV=1 1 140 3.0E-31
sp|A5DRE8|TVP23_PICGU Golgi apparatus membrane protein TVP23 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TVP23 PE=3 SV=2 3 120 2.0E-30
sp|B0CQN9|TVP23_LACBS Golgi apparatus membrane protein TVP23 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=TVP23 PE=3 SV=1 4 123 1.0E-29
sp|A3LRT4|TVP23_PICST Golgi apparatus membrane protein TVP23 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TVP23 PE=3 SV=2 11 144 3.0E-29
sp|A8N1Z1|TVP23_COPC7 Golgi apparatus membrane protein TVP23 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TVP23 PE=3 SV=2 11 112 6.0E-27
sp|P38962|TVP23_YEAST Golgi apparatus membrane protein TVP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TVP23 PE=1 SV=1 3 120 8.0E-25
sp|A6ZY50|TVP23_YEAS7 Golgi apparatus membrane protein TVP23 OS=Saccharomyces cerevisiae (strain YJM789) GN=TVP23 PE=3 SV=1 3 120 8.0E-25
sp|Q74ZP5|TVP23_ASHGO Golgi apparatus membrane protein TVP23 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TVP23 PE=3 SV=1 4 112 4.0E-24
sp|Q5R9I4|TV23B_PONAB Golgi apparatus membrane protein TVP23 homolog B OS=Pongo abelii GN=TVP23B PE=2 SV=1 4 145 8.0E-24
sp|A7TGB4|TVP23_VANPO Golgi apparatus membrane protein TVP23 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TVP23 PE=3 SV=1 3 118 2.0E-23
sp|Q6CTK9|TVP23_KLULA Golgi apparatus membrane protein TVP23 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TVP23 PE=3 SV=1 3 112 2.0E-23
sp|Q29S14|TV23B_BOVIN Golgi apparatus membrane protein TVP23 homolog B OS=Bos taurus GN=TVP23B PE=2 SV=1 4 145 3.0E-23
sp|Q6FM91|TVP23_CANGA Golgi apparatus membrane protein TVP23 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TVP23 PE=3 SV=1 2 112 3.0E-23
sp|Q9D8T4|TV23B_MOUSE Golgi apparatus membrane protein TVP23 homolog B OS=Mus musculus GN=Tvp23b PE=1 SV=1 4 145 8.0E-23
sp|Q9NYZ1|TV23B_HUMAN Golgi apparatus membrane protein TVP23 homolog B OS=Homo sapiens GN=TVP23B PE=1 SV=2 4 145 8.0E-23
sp|Q8LEK2|TVP23_ARATH Golgi apparatus membrane protein-like protein ECHIDNA OS=Arabidopsis thaliana GN=ECH PE=1 SV=1 1 112 1.0E-22
sp|A6NH52|TV23A_HUMAN Golgi apparatus membrane protein TVP23 homolog A OS=Homo sapiens GN=TVP23A PE=2 SV=3 3 110 7.0E-20
sp|Q18449|YC2L_CAEEL Uncharacterized Golgi apparatus membrane protein-like protein C34D4.4 OS=Caenorhabditis elegans GN=C34D4.4 PE=3 SV=2 3 110 3.0E-19
sp|Q86I95|TV23A_DICDI Uncharacterized Golgi apparatus membrane protein-like protein 1 OS=Dictyostelium discoideum GN=DDB_G0276319 PE=3 SV=1 1 141 4.0E-19
sp|Q8IQC1|TVP23_DROME Uncharacterized Golgi apparatus membrane protein-like protein CG5021 OS=Drosophila melanogaster GN=CG5021 PE=2 SV=2 3 111 3.0E-18
sp|Q96ET8|TV23C_HUMAN Golgi apparatus membrane protein TVP23 homolog C OS=Homo sapiens GN=TVP23C PE=1 SV=3 4 90 4.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 62 84 22
2 88 107 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2934
MIFIITILLLAADFYYLKNIAGRRLVGLRWWNEVDVQTGHSKWVFESSEPGARLINATDSRFFWLALYVQPLLWL
LMAILAIVRLQFLWLPLVVIALILTIMNSLAFSRCDKFSQASNMAGSAIGTSNLAGSIASNMFGRLFSRN*
Coding >Ophun1|2934
ATGATCTTCATCATAACCATCCTCCTCCTCGCCGCCGACTTCTACTACCTCAAGAACATCGCCGGCCGAAGACTG
GTTGGCCTCCGGTGGTGGAACGAAGTCGACGTCCAGACGGGCCATTCCAAATGGGTCTTTGAGAGCAGCGAGCCC
GGCGCCCGCCTCATCAACGCCACCGACTCGCGCTTCTTCTGGCTCGCCCTCTACGTCCAGCCCCTCCTCTGGCTC
CTCATGGCCATCCTCGCCATCGTGAGGTTGCAGTTCCTATGGCTTCCCCTCGTCGTCATCGCCCTCATCCTCACA
ATCATGAACTCGCTGGCCTTCTCCCGCTGCGATAAATTCAGCCAGGCCTCCAACATGGCAGGCTCCGCCATCGGA
ACCTCCAATCTCGCCGGCAGCATCGCCTCCAACATGTTTGGCCGCCTCTTCTCCCGCAATTGA
Transcript >Ophun1|2934
ATGATCTTCATCATAACCATCCTCCTCCTCGCCGCCGACTTCTACTACCTCAAGAACATCGCCGGCCGAAGACTG
GTTGGCCTCCGGTGGTGGAACGAAGTCGACGTCCAGACGGGCCATTCCAAATGGGTCTTTGAGAGCAGCGAGCCC
GGCGCCCGCCTCATCAACGCCACCGACTCGCGCTTCTTCTGGCTCGCCCTCTACGTCCAGCCCCTCCTCTGGCTC
CTCATGGCCATCCTCGCCATCGTGAGGTTGCAGTTCCTATGGCTTCCCCTCGTCGTCATCGCCCTCATCCTCACA
ATCATGAACTCGCTGGCCTTCTCCCGCTGCGATAAATTCAGCCAGGCCTCCAACATGGCAGGCTCCGCCATCGGA
ACCTCCAATCTCGCCGGCAGCATCGCCTCCAACATGTTTGGCCGCCTCTTCTCCCGCAATTGA
Gene >Ophun1|2934
ATGATCTTCATCATAACCATCCTCCTCCTCGCCGCCGACTTCTACTACCTCAAGAACATCGCCGGCCGAAGACTG
GTTGGCCTCCGGTGGTGGAACGAAGTCGACGTCCAGACGGGCCATTCCAAATGGGTCTTTGAGAGCAGCGAGCCC
GGCGCCCGCCTCATCAACGCCACCGACTCGCGCTTCTTCTGGCTCGCCCTCTACGTCCAGCCCCTCCTCTGGCTC
CTCATGGCCATCCTCGCCATCGTGAGGTTGCAGTTCCTATGGCTTCCCCTCGTCGGTTCGTTCCCCCCCCCCCAT
TTGTTGCTTTGCTCAACCCGTCCTCGGGTCATGGAGAAATTGACAAATGGTTGCAAAAAAAAAGTCATCGCCCTC
ATCCTCACAATCATGAACTCGCTGGCCTTCTCCCGCTGCGATAAATTCAGCCAGGCCTCCAACATGGCAGGCTCC
GCCATCGGAACCTCCAATCTCGCCGGCAGCATCGCCTCCAACATGTTTGGCCGCCTCTTCTCCCGCAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail