Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2931
Gene name
LocationContig_26:55416..56324
Strand+
Gene length (bp)908
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04900 Fcf1 Fcf1 1.6E-30 39 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74862|UTP23_SCHPO rRNA-processing protein utp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp23 PE=3 SV=1 1 231 4.0E-58
sp|Q12339|UTP23_YEAST rRNA-processing protein UTP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP23 PE=1 SV=1 4 228 1.0E-45
sp|Q9BRU9|UTP23_HUMAN rRNA-processing protein UTP23 homolog OS=Homo sapiens GN=UTP23 PE=1 SV=2 4 243 6.0E-16
sp|Q9CX11|UTP23_MOUSE rRNA-processing protein UTP23 homolog OS=Mus musculus GN=Utp23 PE=2 SV=1 4 153 8.0E-15
sp|Q08DU1|UTP23_BOVIN rRNA-processing protein UTP23 homolog OS=Bos taurus GN=UTP23 PE=2 SV=1 4 153 4.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74862|UTP23_SCHPO rRNA-processing protein utp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp23 PE=3 SV=1 1 231 4.0E-58
sp|Q12339|UTP23_YEAST rRNA-processing protein UTP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP23 PE=1 SV=1 4 228 1.0E-45
sp|Q9BRU9|UTP23_HUMAN rRNA-processing protein UTP23 homolog OS=Homo sapiens GN=UTP23 PE=1 SV=2 4 243 6.0E-16
sp|Q9CX11|UTP23_MOUSE rRNA-processing protein UTP23 homolog OS=Mus musculus GN=Utp23 PE=2 SV=1 4 153 8.0E-15
sp|Q08DU1|UTP23_BOVIN rRNA-processing protein UTP23 homolog OS=Bos taurus GN=UTP23 PE=2 SV=1 4 153 4.0E-12
sp|Q5RFQ0|FCF1_PONAB rRNA-processing protein FCF1 homolog OS=Pongo abelii GN=FCF1 PE=2 SV=1 3 151 2.0E-06
sp|Q9Y324|FCF1_HUMAN rRNA-processing protein FCF1 homolog OS=Homo sapiens GN=FCF1 PE=2 SV=1 3 151 2.0E-06
sp|Q32PD0|FCF1_BOVIN rRNA-processing protein FCF1 homolog OS=Bos taurus GN=FCF1 PE=2 SV=1 3 151 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0032040 small-subunit processome Yes
GO:1990904 ribonucleoprotein complex No
GO:0030684 preribosome No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2931
MEQFSMTFGFREPYQVLVDAEMVFDTCRFTMDLSLALQRTLHGKVKPMITQCEIRKLYARKDEPGLDKVIEVAKL
LERRRCGHHPDEFAEPLSTDECMRSVVDPKGKDENKHRYVVASQSQDVRRMLRSIRGVPLIYVRRSVMILEPMSD
ESVQTRTRDEKSKFRAEIKATLGKRKREERTEAGDKSREDGGRSSPLRGDGDDAAATTTERPKKKKKKRGPKGPN
PLSVKKSKKAQKARDMASGRQQRTKDGSGGAPASTDDGGS*
Coding >Ophun1|2931
ATGGAGCAGTTCTCCATGACCTTTGGTTTCCGCGAGCCGTACCAAGTGCTTGTGGATGCCGAGATGGTTTTCGAC
ACGTGCCGATTCACAATGGATCTCAGTCTGGCGCTCCAGCGAACGCTGCATGGCAAAGTTAAGCCGATGATAACC
CAATGTGAGATTCGAAAATTGTACGCGCGAAAAGACGAGCCGGGGCTTGACAAGGTCATCGAGGTGGCCAAGCTG
TTGGAACGAAGACGGTGCGGTCATCATCCGGACGAATTCGCCGAGCCTCTCAGCACCGATGAATGCATGCGATCG
GTAGTAGACCCCAAGGGAAAAGACGAGAACAAGCATCGATACGTGGTGGCAAGTCAGAGTCAGGATGTCAGACGA
ATGCTGCGCAGCATACGAGGGGTGCCGCTCATCTACGTACGGCGAAGCGTCATGATCCTAGAGCCCATGTCCGAC
GAGAGCGTGCAGACGCGGACGCGGGACGAGAAGAGCAAGTTCAGAGCCGAGATCAAGGCGACGCTCGGGAAGAGG
AAGCGGGAAGAAAGGACCGAGGCCGGCGACAAGAGCCGGGAAGACGGGGGCCGCTCTTCGCCTTTGCGCGGTGAC
GGAGACGATGCTGCGGCCACGACGACGGAGAGGCCCAAGAAGAAGAAGAAGAAGCGAGGACCAAAGGGCCCCAAC
CCTCTATCGGTGAAAAAGTCCAAGAAGGCGCAGAAGGCGAGGGACATGGCGTCAGGGAGACAACAACGGACAAAG
GATGGTTCTGGGGGGGCGCCAGCAAGCACAGACGACGGTGGCAGCTGA
Transcript >Ophun1|2931
ATGGAGCAGTTCTCCATGACCTTTGGTTTCCGCGAGCCGTACCAAGTGCTTGTGGATGCCGAGATGGTTTTCGAC
ACGTGCCGATTCACAATGGATCTCAGTCTGGCGCTCCAGCGAACGCTGCATGGCAAAGTTAAGCCGATGATAACC
CAATGTGAGATTCGAAAATTGTACGCGCGAAAAGACGAGCCGGGGCTTGACAAGGTCATCGAGGTGGCCAAGCTG
TTGGAACGAAGACGGTGCGGTCATCATCCGGACGAATTCGCCGAGCCTCTCAGCACCGATGAATGCATGCGATCG
GTAGTAGACCCCAAGGGAAAAGACGAGAACAAGCATCGATACGTGGTGGCAAGTCAGAGTCAGGATGTCAGACGA
ATGCTGCGCAGCATACGAGGGGTGCCGCTCATCTACGTACGGCGAAGCGTCATGATCCTAGAGCCCATGTCCGAC
GAGAGCGTGCAGACGCGGACGCGGGACGAGAAGAGCAAGTTCAGAGCCGAGATCAAGGCGACGCTCGGGAAGAGG
AAGCGGGAAGAAAGGACCGAGGCCGGCGACAAGAGCCGGGAAGACGGGGGCCGCTCTTCGCCTTTGCGCGGTGAC
GGAGACGATGCTGCGGCCACGACGACGGAGAGGCCCAAGAAGAAGAAGAAGAAGCGAGGACCAAAGGGCCCCAAC
CCTCTATCGGTGAAAAAGTCCAAGAAGGCGCAGAAGGCGAGGGACATGGCGTCAGGGAGACAACAACGGACAAAG
GATGGTTCTGGGGGGGCGCCAGCAAGCACAGACGACGGTGGCAGCTGA
Gene >Ophun1|2931
ATGGAGCAGTTCTCCATGACCTTTGGTTTCCGCGAGCCGTACCAAGTGCTTGGTGTGTCACGGTCACAGGGCTCA
AGTGTCTGGCTCGACTGACGATGGGATTCCTAGTGGATGCCGAGATGGTTTTCGACACGTGCCGATTCACAATGG
ATCTCAGTCTGGCGCTCCAGCGAACGCTGCATGGCAAAGTTAAGCCGAGTAAGTTGAAAGAGCTCGGCGCGGGCC
GGAGGCAGAACTGACAGACAGCCCAAGTGATAACCCAATGTGAGATTCGAAAATTGTACGCGCGAAAAGACGAGC
CGGGGCTTGACAAGGTCATCGAGGTGGCCAAGCTGTTGGAACGAAGACGGTGCGGTCATCATCCGGACGAATTCG
CCGAGCCTCTCAGCACCGATGAATGCATGCGATCGGTAGTAGACCCCAAGGGAAAAGACGAGAACAAGCATCGAT
ACGTGGTGGCAAGTCAGAGTCAGGATGTCAGACGAATGCTGCGCAGCATACGAGGGGTGCCGCTCATCTACGTAC
GGCGAAGCGTCATGATCCTAGAGCCCATGTCCGACGAGAGCGTGCAGACGCGGACGCGGGACGAGAAGAGCAAGT
TCAGAGCCGAGATCAAGGCGACGCTCGGGAAGAGGAAGCGGGAAGAAAGGACCGAGGCCGGCGACAAGAGCCGGG
AAGACGGGGGCCGCTCTTCGCCTTTGCGCGGTGACGGAGACGATGCTGCGGCCACGACGACGGAGAGGCCCAAGA
AGAAGAAGAAGAAGCGAGGACCAAAGGGCCCCAACCCTCTATCGGTGAAAAAGTCCAAGAAGGCGCAGAAGGCGA
GGGACATGGCGTCAGGGAGACAACAACGGACAAAGGATGGTTCTGGGGGGGCGCCAGCAAGCACAGACGACGGTG
GCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail