Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2928
Gene name
LocationContig_26:42010..45538
Strand-
Gene length (bp)3528
Transcript length (bp)3408
Coding sequence length (bp)3408
Protein length (aa) 1136

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.6E-61 281 564
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 7.6E-27 286 559
PF00498 FHA FHA domain 1.6E-08 114 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 112 564 2.0E-50
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 98 564 2.0E-46
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 278 567 2.0E-41
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 279 612 1.0E-39
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 269 570 3.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 112 564 2.0E-50
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 98 564 2.0E-46
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 278 567 2.0E-41
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 279 612 1.0E-39
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 269 570 3.0E-39
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 269 570 3.0E-39
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 280 569 3.0E-38
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 273 568 6.0E-38
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 280 568 1.0E-37
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 281 564 1.0E-37
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 280 564 9.0E-37
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 280 569 1.0E-36
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 280 564 2.0E-36
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 280 575 2.0E-36
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 287 566 7.0E-36
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 281 568 9.0E-36
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 287 574 9.0E-36
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 287 569 2.0E-35
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 280 564 5.0E-35
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 286 564 9.0E-35
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 286 569 1.0E-34
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 279 590 1.0E-34
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 280 564 2.0E-34
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 279 564 2.0E-34
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 280 564 2.0E-34
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 279 564 2.0E-34
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 286 569 3.0E-34
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 286 569 3.0E-34
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 281 564 3.0E-34
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 287 589 3.0E-34
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 287 587 6.0E-34
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 281 564 6.0E-34
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 286 569 7.0E-34
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 280 564 9.0E-34
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 225 567 1.0E-33
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 287 569 1.0E-33
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 286 569 1.0E-33
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 287 595 1.0E-33
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 286 564 2.0E-33
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 253 564 3.0E-33
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 287 567 3.0E-33
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 287 569 3.0E-33
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 287 569 3.0E-33
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 237 572 3.0E-33
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 277 586 4.0E-33
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 279 564 5.0E-33
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 287 595 5.0E-33
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 279 564 7.0E-33
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 286 564 8.0E-33
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 286 564 9.0E-33
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 287 564 1.0E-32
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 286 564 1.0E-32
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 219 572 1.0E-32
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 286 564 1.0E-32
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 286 564 2.0E-32
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 276 564 2.0E-32
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 280 572 2.0E-32
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 280 572 3.0E-32
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 287 564 3.0E-32
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 287 595 4.0E-32
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 287 564 4.0E-32
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 287 564 4.0E-32
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 287 564 5.0E-32
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 205 572 6.0E-32
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 287 578 7.0E-32
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 280 610 7.0E-32
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 250 572 8.0E-32
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 280 564 2.0E-31
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 287 609 2.0E-31
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 271 564 2.0E-31
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 270 753 2.0E-31
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 287 564 3.0E-31
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 279 564 3.0E-31
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 281 569 4.0E-31
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 281 569 4.0E-31
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 278 572 4.0E-31
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 287 564 5.0E-31
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 287 569 5.0E-31
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 287 569 5.0E-31
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 279 604 6.0E-31
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 255 564 7.0E-31
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 281 552 8.0E-31
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 287 569 8.0E-31
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 287 569 1.0E-30
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 281 569 1.0E-30
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 283 572 1.0E-30
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 287 565 1.0E-30
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 283 572 1.0E-30
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 280 567 1.0E-30
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 283 572 1.0E-30
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 276 564 2.0E-30
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 281 568 2.0E-30
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 281 568 2.0E-30
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 283 572 2.0E-30
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 247 565 2.0E-30
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 279 604 3.0E-30
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 286 591 3.0E-30
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 279 607 3.0E-30
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 287 571 3.0E-30
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 279 564 4.0E-30
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 179 564 4.0E-30
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 287 571 4.0E-30
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 264 564 5.0E-30
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 258 564 5.0E-30
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 286 668 6.0E-30
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 287 564 6.0E-30
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 281 564 6.0E-30
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 281 564 6.0E-30
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 281 564 7.0E-30
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 279 593 7.0E-30
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 281 564 7.0E-30
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 281 564 8.0E-30
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 283 564 1.0E-29
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 270 564 1.0E-29
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 287 571 1.0E-29
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 286 564 1.0E-29
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 271 575 1.0E-29
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 279 594 2.0E-29
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 279 564 2.0E-29
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 287 603 2.0E-29
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 271 575 2.0E-29
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 281 564 2.0E-29
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 286 564 2.0E-29
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 286 564 2.0E-29
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 280 578 2.0E-29
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 276 564 2.0E-29
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 283 567 2.0E-29
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 287 594 3.0E-29
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 279 564 3.0E-29
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 287 564 4.0E-29
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 286 567 4.0E-29
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 279 567 4.0E-29
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 287 564 4.0E-29
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 283 564 4.0E-29
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 287 564 4.0E-29
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 250 573 5.0E-29
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 287 586 6.0E-29
sp|A8XWC4|DKF1_CAEBR Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis briggsae GN=dkf-1 PE=3 SV=2 286 566 6.0E-29
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 280 578 6.0E-29
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 281 589 6.0E-29
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 265 564 6.0E-29
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 287 564 6.0E-29
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 274 580 7.0E-29
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 255 571 8.0E-29
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 256 564 8.0E-29
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 256 564 9.0E-29
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 287 564 9.0E-29
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 279 592 1.0E-28
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 287 563 1.0E-28
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 283 564 1.0E-28
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 279 564 1.0E-28
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 280 614 1.0E-28
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 280 564 1.0E-28
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 256 575 1.0E-28
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 279 564 1.0E-28
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 281 562 2.0E-28
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 279 566 2.0E-28
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 279 592 2.0E-28
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 280 548 2.0E-28
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 280 584 3.0E-28
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 277 566 3.0E-28
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 277 564 3.0E-28
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 266 564 3.0E-28
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 256 564 4.0E-28
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 287 567 4.0E-28
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 287 567 4.0E-28
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 287 567 4.0E-28
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 255 575 5.0E-28
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 279 563 5.0E-28
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 287 577 5.0E-28
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 279 564 5.0E-28
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 280 578 6.0E-28
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 280 575 6.0E-28
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 279 564 7.0E-28
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 286 567 8.0E-28
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 286 570 8.0E-28
sp|Q8IW41|MAPK5_HUMAN MAP kinase-activated protein kinase 5 OS=Homo sapiens GN=MAPKAPK5 PE=1 SV=2 308 600 9.0E-28
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 287 594 1.0E-27
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 287 567 1.0E-27
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 278 573 1.0E-27
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 280 567 1.0E-27
sp|Q9XUJ7|DKF1_CAEEL Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis elegans GN=dkf-1 PE=1 SV=1 286 566 1.0E-27
sp|O54992|MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus GN=Mapkapk5 PE=1 SV=1 308 600 1.0E-27
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 256 564 1.0E-27
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 277 564 1.0E-27
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 279 568 1.0E-27
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 280 564 1.0E-27
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 279 592 1.0E-27
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 279 563 1.0E-27
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 270 573 1.0E-27
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 287 571 1.0E-27
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 287 589 1.0E-27
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 287 611 1.0E-27
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 260 503 2.0E-27
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 274 603 2.0E-27
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 287 566 2.0E-27
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 260 503 2.0E-27
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 286 564 2.0E-27
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 287 565 2.0E-27
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 279 564 2.0E-27
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 287 567 2.0E-27
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 280 534 3.0E-27
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 287 564 3.0E-27
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 279 583 3.0E-27
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 281 574 3.0E-27
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 280 534 3.0E-27
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 280 575 3.0E-27
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 280 575 3.0E-27
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 280 564 3.0E-27
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 231 564 3.0E-27
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 280 534 3.0E-27
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 260 564 3.0E-27
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 278 605 3.0E-27
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 278 564 4.0E-27
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 287 571 4.0E-27
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 287 564 4.0E-27
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 281 564 4.0E-27
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 257 564 4.0E-27
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 277 564 5.0E-27
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 286 576 5.0E-27
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 287 564 5.0E-27
sp|Q7RX99|ATG1_NEUCR Serine/threonine-protein kinase apg-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-1 PE=3 SV=2 281 562 6.0E-27
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 281 564 6.0E-27
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 287 571 6.0E-27
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 259 564 6.0E-27
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 287 569 6.0E-27
sp|Q9M9E9|SRK2C_ARATH Serine/threonine-protein kinase SRK2C OS=Arabidopsis thaliana GN=SRK2C PE=1 SV=1 280 567 7.0E-27
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 287 564 7.0E-27
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 281 572 8.0E-27
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 252 564 9.0E-27
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 279 605 9.0E-27
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 287 569 1.0E-26
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 280 564 1.0E-26
sp|Q1ZXC8|PXI_DICDI Probable serine/threonine-protein kinase pXi OS=Dictyostelium discoideum GN=pXi PE=2 SV=1 287 566 1.0E-26
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 275 570 1.0E-26
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 279 592 1.0E-26
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 287 567 1.0E-26
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 278 564 1.0E-26
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 279 517 1.0E-26
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 286 564 2.0E-26
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 287 571 2.0E-26
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 287 564 2.0E-26
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 276 661 2.0E-26
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 279 564 2.0E-26
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 287 578 2.0E-26
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 280 535 2.0E-26
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 249 503 2.0E-26
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 286 580 2.0E-26
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 274 564 2.0E-26
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 287 564 2.0E-26
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 287 575 2.0E-26
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 287 571 2.0E-26
sp|Q6H9I1|ATG1_BOTFU Serine/threonine-protein kinase ATG1 OS=Botryotinia fuckeliana GN=atg1 PE=3 SV=1 273 562 2.0E-26
sp|A6RYB8|ATG1_BOTFB Serine/threonine-protein kinase atg1 OS=Botryotinia fuckeliana (strain B05.10) GN=atg1 PE=3 SV=1 273 562 2.0E-26
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 279 564 2.0E-26
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 272 564 2.0E-26
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 287 570 2.0E-26
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 280 589 3.0E-26
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 279 564 3.0E-26
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 280 564 3.0E-26
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 281 566 3.0E-26
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 280 503 3.0E-26
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 279 564 3.0E-26
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 281 564 3.0E-26
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 245 565 3.0E-26
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 281 568 4.0E-26
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 281 647 4.0E-26
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 265 580 4.0E-26
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 279 564 4.0E-26
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 279 580 4.0E-26
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 287 566 4.0E-26
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 287 576 4.0E-26
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 279 569 4.0E-26
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 287 564 4.0E-26
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 281 561 5.0E-26
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 279 592 5.0E-26
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 279 564 5.0E-26
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 279 600 5.0E-26
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 279 564 5.0E-26
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 280 591 5.0E-26
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 281 568 5.0E-26
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 269 565 5.0E-26
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 281 568 6.0E-26
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 280 564 6.0E-26
sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 287 564 6.0E-26
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 287 564 6.0E-26
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 279 564 6.0E-26
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 280 564 6.0E-26
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 287 564 6.0E-26
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 253 564 6.0E-26
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 279 564 6.0E-26
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 280 564 6.0E-26
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 287 564 6.0E-26
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 287 569 7.0E-26
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 287 565 7.0E-26
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 254 569 7.0E-26
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 274 507 7.0E-26
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 287 565 7.0E-26
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 287 567 7.0E-26
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 279 603 7.0E-26
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 280 564 8.0E-26
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 287 564 8.0E-26
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 279 564 8.0E-26
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 281 503 8.0E-26
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 281 566 8.0E-26
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 276 564 8.0E-26
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 263 564 8.0E-26
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 263 591 9.0E-26
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 280 628 9.0E-26
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 280 564 9.0E-26
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 274 507 1.0E-25
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 287 564 1.0E-25
sp|Q6GLS4|CAMKV_XENLA CaM kinase-like vesicle-associated protein OS=Xenopus laevis GN=camkv PE=2 SV=1 278 570 1.0E-25
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 276 571 1.0E-25
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 287 565 1.0E-25
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 281 564 1.0E-25
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 281 564 1.0E-25
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 286 576 1.0E-25
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 280 571 1.0E-25
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 278 564 1.0E-25
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 276 564 1.0E-25
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 287 564 1.0E-25
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 287 581 1.0E-25
sp|P24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEK1 PE=3 SV=1 115 565 1.0E-25
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 280 564 2.0E-25
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 287 567 2.0E-25
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 287 503 2.0E-25
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 287 581 2.0E-25
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 274 564 2.0E-25
sp|P87248|ATG1_COLLN Serine/threonine-protein kinase ATG1 OS=Colletotrichum lindemuthianum GN=ATG1 PE=3 SV=1 279 552 2.0E-25
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 253 564 2.0E-25
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 268 564 2.0E-25
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 279 564 2.0E-25
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 287 576 2.0E-25
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 287 581 2.0E-25
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 281 564 2.0E-25
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 280 582 2.0E-25
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 280 582 2.0E-25
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 282 568 2.0E-25
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 265 564 2.0E-25
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 287 567 2.0E-25
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 279 567 2.0E-25
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 280 582 2.0E-25
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 280 582 2.0E-25
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 287 564 2.0E-25
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 279 567 2.0E-25
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 279 564 2.0E-25
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 263 558 2.0E-25
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 279 564 2.0E-25
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 279 567 2.0E-25
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 280 564 2.0E-25
sp|Q3UHL1|CAMKV_MOUSE CaM kinase-like vesicle-associated protein OS=Mus musculus GN=Camkv PE=1 SV=2 280 570 3.0E-25
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 281 567 3.0E-25
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 280 564 3.0E-25
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 280 564 3.0E-25
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 287 610 3.0E-25
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 268 564 3.0E-25
sp|Q8NCB2|CAMKV_HUMAN CaM kinase-like vesicle-associated protein OS=Homo sapiens GN=CAMKV PE=2 SV=2 280 570 3.0E-25
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 287 610 3.0E-25
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 279 614 3.0E-25
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 280 582 3.0E-25
sp|Q96RG2|PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3 278 564 3.0E-25
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 280 564 3.0E-25
sp|Q8TGI1|ATG1_PICPA Serine/threonine-protein kinase ATG1 OS=Komagataella pastoris GN=ATG1 PE=3 SV=1 279 564 3.0E-25
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 279 564 3.0E-25
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 280 564 3.0E-25
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 279 567 3.0E-25
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 254 569 4.0E-25
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 287 580 4.0E-25
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 279 607 4.0E-25
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 281 568 4.0E-25
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 325 570 4.0E-25
sp|A7KAL2|ATG1_PENRW Serine/threonine-protein kinase atg1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg1 PE=3 SV=1 279 561 4.0E-25
sp|Q63092|CAMKV_RAT CaM kinase-like vesicle-associated protein OS=Rattus norvegicus GN=Camkv PE=1 SV=1 292 570 5.0E-25
sp|Q9BXA7|TSSK1_HUMAN Testis-specific serine/threonine-protein kinase 1 OS=Homo sapiens GN=TSSK1B PE=1 SV=1 287 595 5.0E-25
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 281 568 5.0E-25
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 279 564 5.0E-25
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 287 564 5.0E-25
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 280 568 6.0E-25
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 287 610 6.0E-25
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 279 594 6.0E-25
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 258 566 7.0E-25
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 286 564 7.0E-25
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 281 564 7.0E-25
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 281 564 7.0E-25
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 324 588 7.0E-25
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 286 564 8.0E-25
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 287 564 9.0E-25
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 281 503 9.0E-25
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 279 564 9.0E-25
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 279 564 9.0E-25
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 287 626 9.0E-25
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 287 564 1.0E-24
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 252 503 1.0E-24
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 286 569 1.0E-24
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 280 564 1.0E-24
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 258 606 1.0E-24
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 280 564 1.0E-24
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 280 564 1.0E-24
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 287 566 1.0E-24
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 287 567 1.0E-24
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 280 568 1.0E-24
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 280 582 1.0E-24
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 267 564 1.0E-24
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 287 567 1.0E-24
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 287 567 1.0E-24
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 268 564 1.0E-24
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 279 589 1.0E-24
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 281 564 2.0E-24
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 287 610 2.0E-24
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 279 610 2.0E-24
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 280 564 2.0E-24
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 287 569 2.0E-24
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 269 575 2.0E-24
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 281 591 2.0E-24
sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 281 568 2.0E-24
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 279 564 2.0E-24
sp|Q96PN8|TSSK3_HUMAN Testis-specific serine/threonine-protein kinase 3 OS=Homo sapiens GN=TSSK3 PE=1 SV=1 278 565 2.0E-24
sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 281 568 2.0E-24
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 281 564 2.0E-24
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 286 575 2.0E-24
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 247 600 2.0E-24
sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 281 568 2.0E-24
sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens GN=STK17A PE=1 SV=2 287 564 2.0E-24
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 286 558 2.0E-24
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 286 558 2.0E-24
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 281 564 2.0E-24
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 265 503 2.0E-24
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 280 564 2.0E-24
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 256 568 2.0E-24
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 286 568 2.0E-24
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 327 565 2.0E-24
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 280 567 3.0E-24
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 267 564 3.0E-24
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 281 570 3.0E-24
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 280 605 3.0E-24
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 280 582 3.0E-24
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 281 565 3.0E-24
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 280 564 3.0E-24
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 278 565 3.0E-24
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 277 568 3.0E-24
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 280 564 3.0E-24
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 280 564 3.0E-24
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 280 564 3.0E-24
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 281 564 3.0E-24
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 278 571 3.0E-24
sp|Q2UGZ7|ATG1_ASPOR Serine/threonine-protein kinase atg1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg1 PE=3 SV=1 279 558 3.0E-24
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 280 568 3.0E-24
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 271 612 3.0E-24
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 281 503 3.0E-24
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 285 564 3.0E-24
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 277 568 3.0E-24
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 277 568 3.0E-24
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 277 568 3.0E-24
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 280 568 3.0E-24
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 280 564 3.0E-24
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 280 568 4.0E-24
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 279 564 4.0E-24
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 287 564 4.0E-24
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 264 503 4.0E-24
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 281 564 4.0E-24
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 264 503 4.0E-24
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 281 503 4.0E-24
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 281 564 4.0E-24
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 267 564 4.0E-24
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 250 566 4.0E-24
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 281 564 4.0E-24
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 268 564 4.0E-24
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 281 503 4.0E-24
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 286 564 4.0E-24
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 286 568 4.0E-24
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 281 564 4.0E-24
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 279 558 4.0E-24
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 279 564 4.0E-24
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 286 564 5.0E-24
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 279 564 5.0E-24
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 280 588 5.0E-24
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 287 564 5.0E-24
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 287 568 5.0E-24
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 281 567 5.0E-24
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 280 588 5.0E-24
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 280 588 5.0E-24
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 287 580 5.0E-24
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 273 576 5.0E-24
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 273 518 5.0E-24
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 280 567 5.0E-24
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 287 564 6.0E-24
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 265 564 6.0E-24
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 279 594 6.0E-24
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 287 569 6.0E-24
sp|P53104|ATG1_YEAST Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG1 PE=1 SV=1 264 527 6.0E-24
sp|A6ZU07|ATG1_YEAS7 Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG1 PE=3 SV=1 264 527 6.0E-24
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 280 572 6.0E-24
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 279 564 6.0E-24
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 280 609 6.0E-24
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 276 564 7.0E-24
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 280 503 7.0E-24
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 287 564 7.0E-24
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 277 568 7.0E-24
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 278 567 7.0E-24
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 280 503 5.0E-20
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 280 503 6.0E-20
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 286 568 9.0E-20
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 281 503 1.0E-19
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 280 503 1.0E-18
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 280 453 1.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0043412 macromolecule modification No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2928
MDGEEQTQQTQATQNVLDPRRIGKQNSGFSDEDVSDIICVLYPHSDAARQEVDRLACEDSPHVVGKRATDNVEPD
YDVEDHASRFNANPVGHGDYAIVLRLSAKVKNPAAGFAFGRNASRCDIVFVNDPMRRISNVHFCIYVNEYGNVMI
KDSSTNGTTVDRQLLTAYPRNKTVPVTRRVLSSGCDIMIPLHKEDCDLTFRVRIPRRDNEYDQAYIAKVHQHFDR
HNLLKGDADAAGNRTGGHVDLFKTPGEPVNQPRPSAFRRNDTTAIVNREWNGSGKYNRVGTIGKGAFAIVYRVTS
KYDGLPYAAKEIEKRRFIKNGVLDQRVENEMKIMRRVQHPNIVRYIENFEWDDRVLIIIMELVPEGDLGRLLSDG
KFLREDTTQTVAAQLLSALGYLHANNITHRDVKPDNILVDNWEPFRVKLTDFGLSKIVTEQTFLQTFCGTLLYCA
PEVHTEYDEYDDKGVRSRGKKPRRGRGQRYNYAVDIWSLGGVLFFTMTGSPPYPVTSVVSHSELLHKIMSTMLNI
EPLKRHKVSDQGIDFVHRMLQRRPESRATIAELESHPWLGGNDATVSASQPYDEMTDDEAAVKNEEEGEADHVSD
SEGEESQRVRPTMLFGEIDASAIGSSGVLPSDYLDLPNPSMGETKILQPHTDDDSGDSDAKDGPKHYYLRAAREQ
SRDQLQSLVDDVASQSLGKEEPRSSVQDLDANTSKRKPPSSDSSGDMENYTSLGQPTIKRLKSQEADVTDERRRE
YLLLASIPQVIRLSSGRQVDHPVNKVVFWKQDLETWHLQYPEMMQLQLDAFNEAARRRGEEFAPDKTPLWDLAMK
YFPPRERTDAQAGDEEGSMPLTATSGPGQQPADPAIVVPMQDDARAIAAVESMADSVIPNIWFTVTDSLVSFGRG
PDNTHKFRPKLEPRVPKYAFKLMLWKEGYDPSLSKSPPWQAPSSAVDASYHFWISTKATLGIRINGQHLASSDAK
NASGPARHWAKVHDGDSLMVWGGQDAQHQKTHLVFRCFWGGSSQARTRRKLELADASLADRLDAACQRTEQRIRD
VSERRRRSAEAEQEQKERQGQVEQERQLGYDFEKKRAAAVEYLTATQQLGSLGSRRASPAMHSPSRANRLLQATT
TGTMPSRQGR*
Coding >Ophun1|2928
ATGGACGGCGAGGAGCAGACGCAGCAGACTCAAGCTACCCAGAATGTGCTCGATCCTCGCCGAATCGGCAAGCAG
AACTCGGGCTTCTCCGATGAGGACGTCTCGGACATCATCTGCGTTCTCTACCCGCACTCGGACGCCGCTCGTCAA
GAGGTTGATCGCCTTGCCTGCGAGGACTCGCCCCATGTCGTCGGCAAACGCGCCACGGACAATGTCGAGCCCGAC
TACGACGTAGAGGATCATGCCAGTCGCTTCAACGCCAACCCTGTCGGCCACGGCGACTACGCCATCGTCTTACGT
CTGTCGGCAAAAGTCAAGAACCCGGCCGCTGGCTTCGCCTTTGGCAGAAACGCCAGCCGCTGTGACATCGTCTTC
GTCAACGACCCCATGAGGAGGATCAGCAATGTTCACTTCTGCATCTACGTCAACGAGTACGGCAACGTCATGATC
AAGGACTCGTCCACCAACGGCACCACGGTCGACAGGCAGCTCCTCACCGCCTATCCCCGGAACAAGACGGTCCCC
GTCACCAGACGCGTCCTGAGCTCCGGCTGTGACATCATGATACCCCTTCACAAGGAGGACTGCGACCTGACGTTT
CGCGTCCGCATCCCGCGCCGTGACAACGAGTATGACCAGGCCTACATAGCAAAGGTCCATCAGCACTTTGACAGG
CACAATCTCCTCAAGGGGGATGCCGACGCCGCCGGCAACCGCACTGGCGGTCATGTCGACTTGTTTAAGACACCC
GGCGAGCCCGTCAACCAACCCCGTCCCTCTGCGTTCCGCCGCAACGACACGACAGCCATCGTAAACAGGGAATGG
AACGGCTCCGGAAAGTACAACCGCGTCGGTACCATTGGCAAGGGCGCCTTCGCCATCGTCTACAGGGTCACGTCC
AAGTACGACGGCTTGCCGTACGCCGCAAAGGAGATTGAAAAGCGCCGTTTCATCAAGAATGGAGTGCTGGATCAA
AGAGTGGAAAACGAGATGAAGATTATGCGGCGAGTCCAGCACCCAAACATCGTCCGGTACATAGAAAACTTCGAG
TGGGACGACCGAGTCCTCATCATCATCATGGAGCTCGTCCCTGAAGGTGACTTGGGAAGACTCCTCTCGGACGGC
AAGTTCTTACGTGAAGACACGACGCAGACCGTGGCCGCCCAGCTGCTGAGCGCGCTCGGCTACCTGCACGCCAAC
AACATCACGCACCGCGACGTCAAGCCCGACAACATCCTCGTCGACAACTGGGAACCCTTCCGCGTCAAGCTCACC
GACTTCGGCCTGTCCAAGATTGTCACGGAGCAGACCTTTCTCCAGACGTTTTGCGGTACCCTGCTGTACTGCGCA
CCCGAGGTGCATACCGAGTACGACGAGTACGACGACAAGGGCGTCAGGAGCCGCGGCAAGAAACCACGCCGAGGC
CGCGGCCAGCGGTACAACTATGCCGTCGACATCTGGTCTCTGGGCGGCGTCCTGTTCTTCACCATGACGGGCTCT
CCTCCGTACCCGGTTACGTCCGTCGTCAGCCACTCGGAGCTCCTGCACAAGATCATGTCGACCATGCTCAACATT
GAGCCCCTGAAGCGCCACAAGGTGTCGGATCAAGGCATCGATTTTGTGCACCGGATGCTGCAGCGGCGCCCGGAG
AGTCGGGCGACGATTGCCGAGCTCGAGAGCCACCCGTGGCTGGGCGGCAACGATGCCACCGTCTCGGCATCGCAG
CCGTACGACGAGATGACGGACGACGAGGCGGCCGTCAAGAACGAAGAAGAGGGAGAAGCCGATCACGTCAGCGAC
TCCGAAGGGGAAGAGTCTCAACGCGTGCGGCCGACCATGTTGTTCGGCGAGATTGACGCCTCGGCCATTGGTAGT
TCGGGCGTGTTACCGTCCGACTATCTCGACCTGCCCAACCCTAGCATGGGCGAGACGAAGATTCTGCAGCCGCAC
ACCGACGACGACTCGGGAGACTCGGATGCCAAGGACGGGCCGAAGCACTATTATCTCCGGGCGGCAAGGGAACAG
TCGAGGGACCAGCTGCAAAGTTTGGTCGATGACGTGGCCTCGCAGAGCCTTGGAAAGGAAGAGCCGCGAAGCTCG
GTGCAGGATCTCGACGCCAACACGAGCAAGCGGAAGCCCCCCTCGTCGGACTCGAGCGGCGACATGGAAAACTAC
ACATCGCTGGGCCAGCCGACGATCAAGAGGCTCAAGTCGCAGGAGGCCGACGTGACGGACGAGAGGCGGCGCGAA
TACCTCCTGCTAGCCAGCATCCCCCAGGTCATACGGCTGAGCTCGGGCCGACAGGTCGACCATCCCGTCAACAAG
GTGGTGTTCTGGAAGCAGGACCTGGAGACGTGGCACCTCCAGTACCCCGAGATGATGCAGCTCCAGCTCGACGCC
TTCAACGAGGCGGCGCGGCGGCGCGGAGAAGAGTTTGCTCCGGACAAGACGCCGCTGTGGGATCTGGCCATGAAG
TACTTCCCCCCTCGTGAGCGGACCGACGCTCAGGCCGGCGACGAAGAGGGCTCGATGCCGTTGACGGCGACGTCC
GGACCGGGACAGCAGCCGGCGGATCCGGCCATCGTGGTGCCGATGCAGGACGACGCGAGAGCCATAGCCGCCGTC
GAGTCCATGGCCGACTCGGTCATACCGAACATCTGGTTCACCGTGACAGACTCGCTCGTGTCCTTTGGTCGCGGC
CCCGACAACACGCACAAGTTCCGTCCCAAGCTGGAGCCCAGAGTCCCCAAGTACGCCTTCAAGTTGATGCTCTGG
AAGGAAGGCTACGATCCGTCGCTGTCCAAGTCGCCGCCCTGGCAGGCGCCCTCTTCGGCCGTCGACGCTTCGTAC
CACTTCTGGATATCGACCAAGGCGACGCTGGGGATCCGAATCAACGGTCAGCACCTGGCATCGTCGGACGCTAAG
AACGCGTCGGGCCCGGCCAGACACTGGGCCAAGGTGCACGACGGCGACTCGCTGATGGTATGGGGCGGCCAGGAC
GCCCAGCACCAGAAGACGCACCTCGTCTTTCGCTGCTTCTGGGGCGGCTCGTCGCAGGCGCGGACCAGGCGAAAG
CTGGAGCTGGCAGACGCCTCGCTGGCCGACCGTCTCGACGCGGCCTGCCAGCGCACCGAGCAACGGATCCGGGAC
GTGTCCGAGAGGCGGCGCCGTTCTGCCGAGGCCGAGCAGGAGCAAAAGGAGCGCCAGGGCCAGGTGGAGCAGGAG
CGCCAGCTGGGATACGACTTTGAGAAGAAGCGGGCTGCTGCGGTTGAGTATCTGACTGCGACGCAGCAGCTGGGC
TCGCTGGGCTCGCGCAGGGCGTCACCGGCGATGCATTCACCGTCGAGGGCCAACAGGCTGCTGCAGGCCACGACT
ACGGGCACGATGCCGTCGAGACAGGGCCGCTAG
Transcript >Ophun1|2928
ATGGACGGCGAGGAGCAGACGCAGCAGACTCAAGCTACCCAGAATGTGCTCGATCCTCGCCGAATCGGCAAGCAG
AACTCGGGCTTCTCCGATGAGGACGTCTCGGACATCATCTGCGTTCTCTACCCGCACTCGGACGCCGCTCGTCAA
GAGGTTGATCGCCTTGCCTGCGAGGACTCGCCCCATGTCGTCGGCAAACGCGCCACGGACAATGTCGAGCCCGAC
TACGACGTAGAGGATCATGCCAGTCGCTTCAACGCCAACCCTGTCGGCCACGGCGACTACGCCATCGTCTTACGT
CTGTCGGCAAAAGTCAAGAACCCGGCCGCTGGCTTCGCCTTTGGCAGAAACGCCAGCCGCTGTGACATCGTCTTC
GTCAACGACCCCATGAGGAGGATCAGCAATGTTCACTTCTGCATCTACGTCAACGAGTACGGCAACGTCATGATC
AAGGACTCGTCCACCAACGGCACCACGGTCGACAGGCAGCTCCTCACCGCCTATCCCCGGAACAAGACGGTCCCC
GTCACCAGACGCGTCCTGAGCTCCGGCTGTGACATCATGATACCCCTTCACAAGGAGGACTGCGACCTGACGTTT
CGCGTCCGCATCCCGCGCCGTGACAACGAGTATGACCAGGCCTACATAGCAAAGGTCCATCAGCACTTTGACAGG
CACAATCTCCTCAAGGGGGATGCCGACGCCGCCGGCAACCGCACTGGCGGTCATGTCGACTTGTTTAAGACACCC
GGCGAGCCCGTCAACCAACCCCGTCCCTCTGCGTTCCGCCGCAACGACACGACAGCCATCGTAAACAGGGAATGG
AACGGCTCCGGAAAGTACAACCGCGTCGGTACCATTGGCAAGGGCGCCTTCGCCATCGTCTACAGGGTCACGTCC
AAGTACGACGGCTTGCCGTACGCCGCAAAGGAGATTGAAAAGCGCCGTTTCATCAAGAATGGAGTGCTGGATCAA
AGAGTGGAAAACGAGATGAAGATTATGCGGCGAGTCCAGCACCCAAACATCGTCCGGTACATAGAAAACTTCGAG
TGGGACGACCGAGTCCTCATCATCATCATGGAGCTCGTCCCTGAAGGTGACTTGGGAAGACTCCTCTCGGACGGC
AAGTTCTTACGTGAAGACACGACGCAGACCGTGGCCGCCCAGCTGCTGAGCGCGCTCGGCTACCTGCACGCCAAC
AACATCACGCACCGCGACGTCAAGCCCGACAACATCCTCGTCGACAACTGGGAACCCTTCCGCGTCAAGCTCACC
GACTTCGGCCTGTCCAAGATTGTCACGGAGCAGACCTTTCTCCAGACGTTTTGCGGTACCCTGCTGTACTGCGCA
CCCGAGGTGCATACCGAGTACGACGAGTACGACGACAAGGGCGTCAGGAGCCGCGGCAAGAAACCACGCCGAGGC
CGCGGCCAGCGGTACAACTATGCCGTCGACATCTGGTCTCTGGGCGGCGTCCTGTTCTTCACCATGACGGGCTCT
CCTCCGTACCCGGTTACGTCCGTCGTCAGCCACTCGGAGCTCCTGCACAAGATCATGTCGACCATGCTCAACATT
GAGCCCCTGAAGCGCCACAAGGTGTCGGATCAAGGCATCGATTTTGTGCACCGGATGCTGCAGCGGCGCCCGGAG
AGTCGGGCGACGATTGCCGAGCTCGAGAGCCACCCGTGGCTGGGCGGCAACGATGCCACCGTCTCGGCATCGCAG
CCGTACGACGAGATGACGGACGACGAGGCGGCCGTCAAGAACGAAGAAGAGGGAGAAGCCGATCACGTCAGCGAC
TCCGAAGGGGAAGAGTCTCAACGCGTGCGGCCGACCATGTTGTTCGGCGAGATTGACGCCTCGGCCATTGGTAGT
TCGGGCGTGTTACCGTCCGACTATCTCGACCTGCCCAACCCTAGCATGGGCGAGACGAAGATTCTGCAGCCGCAC
ACCGACGACGACTCGGGAGACTCGGATGCCAAGGACGGGCCGAAGCACTATTATCTCCGGGCGGCAAGGGAACAG
TCGAGGGACCAGCTGCAAAGTTTGGTCGATGACGTGGCCTCGCAGAGCCTTGGAAAGGAAGAGCCGCGAAGCTCG
GTGCAGGATCTCGACGCCAACACGAGCAAGCGGAAGCCCCCCTCGTCGGACTCGAGCGGCGACATGGAAAACTAC
ACATCGCTGGGCCAGCCGACGATCAAGAGGCTCAAGTCGCAGGAGGCCGACGTGACGGACGAGAGGCGGCGCGAA
TACCTCCTGCTAGCCAGCATCCCCCAGGTCATACGGCTGAGCTCGGGCCGACAGGTCGACCATCCCGTCAACAAG
GTGGTGTTCTGGAAGCAGGACCTGGAGACGTGGCACCTCCAGTACCCCGAGATGATGCAGCTCCAGCTCGACGCC
TTCAACGAGGCGGCGCGGCGGCGCGGAGAAGAGTTTGCTCCGGACAAGACGCCGCTGTGGGATCTGGCCATGAAG
TACTTCCCCCCTCGTGAGCGGACCGACGCTCAGGCCGGCGACGAAGAGGGCTCGATGCCGTTGACGGCGACGTCC
GGACCGGGACAGCAGCCGGCGGATCCGGCCATCGTGGTGCCGATGCAGGACGACGCGAGAGCCATAGCCGCCGTC
GAGTCCATGGCCGACTCGGTCATACCGAACATCTGGTTCACCGTGACAGACTCGCTCGTGTCCTTTGGTCGCGGC
CCCGACAACACGCACAAGTTCCGTCCCAAGCTGGAGCCCAGAGTCCCCAAGTACGCCTTCAAGTTGATGCTCTGG
AAGGAAGGCTACGATCCGTCGCTGTCCAAGTCGCCGCCCTGGCAGGCGCCCTCTTCGGCCGTCGACGCTTCGTAC
CACTTCTGGATATCGACCAAGGCGACGCTGGGGATCCGAATCAACGGTCAGCACCTGGCATCGTCGGACGCTAAG
AACGCGTCGGGCCCGGCCAGACACTGGGCCAAGGTGCACGACGGCGACTCGCTGATGGTATGGGGCGGCCAGGAC
GCCCAGCACCAGAAGACGCACCTCGTCTTTCGCTGCTTCTGGGGCGGCTCGTCGCAGGCGCGGACCAGGCGAAAG
CTGGAGCTGGCAGACGCCTCGCTGGCCGACCGTCTCGACGCGGCCTGCCAGCGCACCGAGCAACGGATCCGGGAC
GTGTCCGAGAGGCGGCGCCGTTCTGCCGAGGCCGAGCAGGAGCAAAAGGAGCGCCAGGGCCAGGTGGAGCAGGAG
CGCCAGCTGGGATACGACTTTGAGAAGAAGCGGGCTGCTGCGGTTGAGTATCTGACTGCGACGCAGCAGCTGGGC
TCGCTGGGCTCGCGCAGGGCGTCACCGGCGATGCATTCACCGTCGAGGGCCAACAGGCTGCTGCAGGCCACGACT
ACGGGCACGATGCCGTCGAGACAGGGCCGCTAG
Gene >Ophun1|2928
ATGGACGGCGAGGAGCAGACGCAGCAGACTCAAGGTGTGCTTCGTCGCTCGCCTCGTGCTCTATAGCTGGGAAGC
CTGACCGTGCCGGGCTTCTAGCTACCCAGAATGTGCTCGATCCTCGCCGAATCGGCAAGCAGAACTCGGGCTTCT
CCGATGAGGACGTCTCGGACATCATCTGCGTTCTCTACCCGCACTCGGACGCCGCTCGTCAAGAGGTTGATCGCC
TTGCCTGCGAGGACTCGCCCCATGTCGTCGGCAAACGCGCCACGGACAATGTCGAGCCCGACTACGACGTAGAGG
ATCATGCCAGTCGCTTCAACGCCAACCCTGTCGGCCACGGCGACTACGCCATCGTCTTACGTCTGTCGGCAAAAG
TCAAGAACCCGGCCGCTGGCTTCGCCTTTGGCAGAAACGCCAGCCGCTGTGACATCGTCTTCGTCAACGACCCCA
TGAGGAGGATCAGCAATGTTCACTTCTGCATCTACGTCAACGAGTACGGCAACGTCATGATCAAGGACTCGTCCA
CCAACGGCACCACGGTCGACAGGCAGCTCCTCACCGCCTATCCCCGGAACAAGACGGTCCCCGTCACCAGACGCG
TCCTGAGCTCCGGCTGTGACATCATGATACCCCTTCACAAGGAGGACTGCGACCTGACGTTTCGCGTCCGCATCC
CGCGCCGTGACAACGAGTATGACCAGGCCTACATAGCAAAGGTCCATCAGCACTTTGACAGGCACAATCTCCTCA
AGGGGGATGCCGACGCCGCCGGCAACCGCACTGGCGGTCATGTCGACTTGTTTAAGACACCCGGCGAGCCCGTCA
ACCAACCCCGTCCCTCTGCGTTCCGCCGCAACGACACGACAGCCATCGTAAACAGGGAATGGAACGGCTCCGGAA
AGTACAACCGCGTCGGTACCATTGGCAAGGGCGCCTTCGCCATCGTCTACAGGGTCACGTCCAAGTACGACGGCT
TGCCGTACGCCGCAAAGGAGATTGAAAAGCGCCGTTTCATCAAGAATGGAGTGCTGGATCAAAGAGTGGAAAACG
AGATGAAGATTATGCGGCGAGTCCAGCACGTAAGGATCGGCCCCCTTCCCGTCTCTGATGGACGCCGACGACTGA
CGGCCCGCGCAGCCAAACATCGTCCGGTACATAGAAAACTTCGAGTGGGACGACCGAGTCCTCATCATCATCATG
GAGCTCGTCCCTGAAGGTGACTTGGGAAGACTCCTCTCGGACGGCAAGTTCTTACGTGAAGACACGACGCAGACC
GTGGCCGCCCAGCTGCTGAGCGCGCTCGGCTACCTGCACGCCAACAACATCACGCACCGCGACGTCAAGCCCGAC
AACATCCTCGTCGACAACTGGGAACCCTTCCGCGTCAAGCTCACCGACTTCGGCCTGTCCAAGATTGTCACGGAG
CAGACCTTTCTCCAGACGTTTTGCGGTACCCTGCTGTACTGCGCACCCGAGGTGCATACCGAGTACGACGAGTAC
GACGACAAGGGCGTCAGGAGCCGCGGCAAGAAACCACGCCGAGGCCGCGGCCAGCGGTACAACTATGCCGTCGAC
ATCTGGTCTCTGGGCGGCGTCCTGTTCTTCACCATGACGGGCTCTCCTCCGTACCCGGTTACGTCCGTCGTCAGC
CACTCGGAGCTCCTGCACAAGATCATGTCGACCATGCTCAACATTGAGCCCCTGAAGCGCCACAAGGTGTCGGAT
CAAGGCATCGATTTTGTGCACCGGATGCTGCAGCGGCGCCCGGAGAGTCGGGCGACGATTGCCGAGCTCGAGAGC
CACCCGTGGCTGGGCGGCAACGATGCCACCGTCTCGGCATCGCAGCCGTACGACGAGATGACGGACGACGAGGCG
GCCGTCAAGAACGAAGAAGAGGGAGAAGCCGATCACGTCAGCGACTCCGAAGGGGAAGAGTCTCAACGCGTGCGG
CCGACCATGTTGTTCGGCGAGATTGACGCCTCGGCCATTGGTAGTTCGGGCGTGTTACCGTCCGACTATCTCGAC
CTGCCCAACCCTAGCATGGGCGAGACGAAGATTCTGCAGCCGCACACCGACGACGACTCGGGAGACTCGGATGCC
AAGGACGGGCCGAAGCACTATTATCTCCGGGCGGCAAGGGAACAGTCGAGGGACCAGCTGCAAAGTTTGGTCGAT
GACGTGGCCTCGCAGAGCCTTGGAAAGGAAGAGCCGCGAAGCTCGGTGCAGGATCTCGACGCCAACACGAGCAAG
CGGAAGCCCCCCTCGTCGGACTCGAGCGGCGACATGGAAAACTACACATCGCTGGGCCAGCCGACGATCAAGAGG
CTCAAGTCGCAGGAGGCCGACGTGACGGACGAGAGGCGGCGCGAATACCTCCTGCTAGCCAGCATCCCCCAGGTC
ATACGGCTGAGCTCGGGCCGACAGGTCGACCATCCCGTCAACAAGGTGGTGTTCTGGAAGCAGGACCTGGAGACG
TGGCACCTCCAGTACCCCGAGATGATGCAGCTCCAGCTCGACGCCTTCAACGAGGCGGCGCGGCGGCGCGGAGAA
GAGTTTGCTCCGGACAAGACGCCGCTGTGGGATCTGGCCATGAAGTACTTCCCCCCTCGTGAGCGGACCGACGCT
CAGGCCGGCGACGAAGAGGGCTCGATGCCGTTGACGGCGACGTCCGGACCGGGACAGCAGCCGGCGGATCCGGCC
ATCGTGGTGCCGATGCAGGACGACGCGAGAGCCATAGCCGCCGTCGAGTCCATGGCCGACTCGGTCATACCGAAC
ATCTGGTTCACCGTGACAGACTCGCTCGTGTCCTTTGGTCGCGGCCCCGACAACACGCACAAGTTCCGTCCCAAG
CTGGAGCCCAGAGTCCCCAAGTACGCCTTCAAGTTGATGCTCTGGAAGGAAGGCTACGATCCGTCGCTGTCCAAG
TCGCCGCCCTGGCAGGCGCCCTCTTCGGCCGTCGACGCTTCGTACCACTTCTGGATATCGACCAAGGCGACGCTG
GGGATCCGAATCAACGGTCAGCACCTGGCATCGTCGGACGCTAAGAACGCGTCGGGCCCGGCCAGACACTGGGCC
AAGGTGCACGACGGCGACTCGCTGATGGTATGGGGCGGCCAGGACGCCCAGCACCAGAAGACGCACCTCGTCTTT
CGCTGCTTCTGGGGCGGCTCGTCGCAGGCGCGGACCAGGCGAAAGCTGGAGCTGGCAGACGCCTCGCTGGCCGAC
CGTCTCGACGCGGCCTGCCAGCGCACCGAGCAACGGATCCGGGACGTGTCCGAGAGGCGGCGCCGTTCTGCCGAG
GCCGAGCAGGAGCAAAAGGAGCGCCAGGGCCAGGTGGAGCAGGAGCGCCAGCTGGGATACGACTTTGAGAAGAAG
CGGGCTGCTGCGGTTGAGTATCTGACTGCGACGCAGCAGCTGGGCTCGCTGGGCTCGCGCAGGGCGTCACCGGCG
ATGCATTCACCGTCGAGGGCCAACAGGCTGCTGCAGGCCACGACTACGGGCACGATGCCGTCGAGACAGGGCCGC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail