Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2926
Gene name
LocationContig_26:35667..38181
Strand+
Gene length (bp)2514
Transcript length (bp)2280
Coding sequence length (bp)2280
Protein length (aa) 760

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02516 STT3 Oligosaccharyl transferase STT3 subunit 5.6E-122 23 517

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94335|STT3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stt3 PE=3 SV=1 1 750 0.0E+00
sp|P39007|STT3_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STT3 PE=1 SV=2 21 755 0.0E+00
sp|P46975|STT3_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt-3 OS=Caenorhabditis elegans GN=stt-3 PE=1 SV=1 11 751 0.0E+00
sp|Q3TDQ1|STT3B_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus GN=Stt3b PE=1 SV=2 10 727 0.0E+00
sp|Q8TCJ2|STT3B_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens GN=STT3B PE=1 SV=1 10 751 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94335|STT3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stt3 PE=3 SV=1 1 750 0.0E+00
sp|P39007|STT3_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STT3 PE=1 SV=2 21 755 0.0E+00
sp|P46975|STT3_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt-3 OS=Caenorhabditis elegans GN=stt-3 PE=1 SV=1 11 751 0.0E+00
sp|Q3TDQ1|STT3B_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus GN=Stt3b PE=1 SV=2 10 727 0.0E+00
sp|Q8TCJ2|STT3B_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens GN=STT3B PE=1 SV=1 10 751 0.0E+00
sp|P46978|STT3A_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Mus musculus GN=Stt3a PE=1 SV=1 18 730 0.0E+00
sp|Q5RCE2|STT3A_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Pongo abelii GN=STT3A PE=2 SV=1 18 730 0.0E+00
sp|P46977|STT3A_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens GN=STT3A PE=1 SV=2 18 730 0.0E+00
sp|Q2KJI2|STT3A_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Bos taurus GN=STT3A PE=2 SV=1 18 730 0.0E+00
sp|Q54NM9|STT3_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Dictyostelium discoideum GN=stt3 PE=3 SV=1 23 727 0.0E+00
sp|Q9FX21|STT3B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Arabidopsis thaliana GN=STT3B PE=2 SV=1 16 724 0.0E+00
sp|Q7XQ88|STT3B_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Oryza sativa subsp. japonica GN=STT3B PE=2 SV=2 8 724 0.0E+00
sp|Q93ZY3|STT3A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Arabidopsis thaliana GN=STT3A PE=2 SV=1 23 751 0.0E+00
sp|Q6F2Z1|STT3A_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Oryza sativa subsp. japonica GN=STT3A PE=2 SV=1 6 724 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0016020 membrane Yes
GO:0004576 oligosaccharyl transferase activity Yes
GO:0043412 macromolecule modification No
GO:0043413 macromolecule glycosylation No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0070085 glycosylation No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0110165 cellular anatomical entity No
GO:0036211 protein modification process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0016757 glycosyltransferase activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 84 106 22
3 113 132 19
4 136 158 22
5 171 193 22
6 208 227 19
7 239 261 22
8 281 303 22
9 315 337 22
10 374 396 22
11 403 421 18
12 425 447 22
13 491 513 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2926
MPPVADQAQLRAAGSKSQSTQALLKVVILCLIAITAVASRLFSVILDPWFNFRATKYLVNNGFYKFWDWFDDRTW
HPLGRVTGGTLYPGLMVTSGIIYHALRAIAIPVDIRNVCVLLAPAFSGLTAYAAYLLTNELTTLPSAGLLAAIFM
GIAPGYISRSVAGSYDNEAIAIFLLVFTFYLWIKALKLGSMLWSVFCALSYGYMVASWGGYAFITCLLPLHTFVL
ICMGRYSPRLYVSYCTWYALGTLASMQIPFVGFLPVKTSEHMPALGMIPRVEEWFVHANLASLGIFGFIQLIAFI
DYVKAAIPSRQFQTFVVTILVAAFGVGLLALVALTSLGYVAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPPAWP
AFFFDLNMLIWLFPAGIYLCFQELRDEHVFVIVYGLFGSYFAGVMVRLMLTLTPIVCVTAAIAMSQLIDIFIRPK
ANPVDEMQSTGEATTKKNVKSGGLRGSEKPLLGIFSSIPRVAVISIVLVYLLMFVSHCTWVTSNAYSSPSVVLAS
RMPDGSQHIIDDYREAYQWLRQNTKENAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIAIVGKAMASREEVSY
EIMRQHEVDYVLVVFGGLLGYSGDDINKFLWMVRIAEGIWPEEIRERDFFTARGEYRVDGEATDAMKNSLMYKMC
YYNYHSLFPPGQVVDRVRGVRMPDKGPTLDVVEEAFTSENWIIRIYKVKDLDILGRDHAAVAAFERGEKRKKAKR
KGPRMLRDP*
Coding >Ophun1|2926
ATGCCTCCCGTGGCAGATCAAGCCCAGCTTCGCGCTGCGGGATCAAAGTCTCAAAGCACCCAGGCTCTTCTCAAA
GTTGTCATTCTGTGCCTCATCGCAATCACCGCCGTTGCCAGTCGCCTCTTCTCTGTCATCCTTGATCCTTGGTTT
AATTTCAGAGCAACAAAGTATCTCGTTAACAACGGATTCTACAAGTTCTGGGATTGGTTTGATGATCGAACATGG
CATCCCCTCGGCCGCGTCACGGGCGGCACGCTGTACCCTGGTCTGATGGTGACGAGCGGCATCATCTATCACGCC
CTCCGCGCCATAGCCATTCCAGTCGATATCCGCAACGTCTGCGTTCTCCTCGCACCGGCCTTTTCTGGCCTGACG
GCGTATGCTGCCTATCTGCTGACCAATGAGCTGACCACTCTGCCGTCTGCTGGCCTCTTGGCGGCCATCTTCATG
GGCATCGCCCCCGGCTACATCTCCAGGTCGGTTGCGGGCAGCTACGATAACGAAGCCATTGCCATCTTCCTCCTC
GTCTTCACCTTTTACCTGTGGATAAAGGCCCTCAAACTGGGATCCATGCTCTGGAGCGTCTTCTGTGCCCTCTCT
TACGGCTACATGGTTGCATCGTGGGGCGGCTACGCTTTCATCACCTGCCTCTTGCCTCTTCATACCTTTGTCCTC
ATCTGCATGGGAAGATATAGCCCCCGACTCTACGTCAGCTACTGCACGTGGTACGCCCTCGGCACCCTGGCCAGC
ATGCAGATCCCTTTCGTCGGCTTCCTCCCCGTCAAGACGAGCGAGCACATGCCGGCTCTGGGTATGATACCTCGC
GTGGAGGAGTGGTTCGTCCACGCTAACCTGGCCTCGCTAGGCATCTTTGGCTTTATTCAACTCATCGCGTTTATC
GATTATGTCAAAGCTGCCATTCCCTCCCGCCAGTTCCAGACCTTTGTCGTCACCATCCTGGTTGCTGCCTTTGGT
GTCGGCCTGCTGGCACTCGTGGCTCTCACTTCTCTGGGCTACGTCGCCCCCTGGAGCGGCCGTTTCTATTCTCTC
TGGGACACGGGCTACGCCAAGATACACATCCCCATCATCGCCTCCGTATCGGAGCATCAGCCGCCGGCCTGGCCT
GCTTTTTTCTTTGACCTCAACATGCTCATCTGGTTGTTCCCGGCAGGCATCTACCTGTGCTTCCAGGAGCTTCGG
GACGAGCACGTCTTTGTCATCGTCTACGGCCTCTTTGGCAGCTACTTCGCCGGCGTCATGGTTCGACTGATGCTC
ACGCTGACGCCCATTGTCTGCGTCACGGCTGCCATTGCCATGTCTCAGCTCATCGACATCTTTATTCGTCCCAAG
GCCAACCCGGTGGATGAAATGCAGAGCACGGGCGAGGCAACGACCAAGAAGAACGTCAAGAGCGGCGGCCTCCGC
GGCAGCGAGAAGCCGCTTCTCGGAATCTTCAGCTCGATCCCGCGGGTGGCTGTCATCTCGATAGTGCTGGTCTAT
CTGCTCATGTTCGTGAGCCACTGCACTTGGGTGACGTCCAACGCCTACTCGTCGCCGTCGGTGGTCCTGGCTAGC
CGGATGCCCGACGGCTCGCAGCACATCATCGACGACTACAGGGAGGCGTACCAGTGGCTCCGACAGAATACCAAG
GAGAATGCCAAGATCATGTCGTGGTGGGACTACGGCTACCAGATTGGCGGCATGGCGGACCGACCGACGCTGGTG
GACAACAATACGTGGAACAACACGCACATTGCCATTGTGGGCAAGGCCATGGCGTCGCGAGAGGAGGTCAGCTAC
GAGATCATGCGACAGCACGAGGTCGACTACGTCCTCGTCGTCTTTGGCGGCCTTTTGGGCTACTCGGGAGACGAT
ATCAACAAGTTCCTCTGGATGGTGCGAATCGCCGAGGGCATCTGGCCGGAAGAGATCAGGGAGCGCGACTTTTTC
ACAGCCCGCGGCGAGTACCGCGTCGACGGCGAGGCGACGGATGCGATGAAGAACAGCTTGATGTACAAGATGTGC
TACTACAACTACCACTCGCTGTTCCCGCCCGGCCAGGTCGTCGACCGTGTCCGCGGCGTTCGGATGCCGGATAAG
GGCCCTACTCTGGACGTGGTGGAAGAGGCGTTTACCAGCGAGAACTGGATCATCCGCATCTACAAGGTCAAGGAT
CTGGACATACTCGGTCGCGACCACGCCGCTGTGGCCGCTTTTGAGCGGGGAGAGAAGCGAAAGAAGGCCAAGAGG
AAAGGGCCGCGCATGCTCCGAGACCCGTAG
Transcript >Ophun1|2926
ATGCCTCCCGTGGCAGATCAAGCCCAGCTTCGCGCTGCGGGATCAAAGTCTCAAAGCACCCAGGCTCTTCTCAAA
GTTGTCATTCTGTGCCTCATCGCAATCACCGCCGTTGCCAGTCGCCTCTTCTCTGTCATCCTTGATCCTTGGTTT
AATTTCAGAGCAACAAAGTATCTCGTTAACAACGGATTCTACAAGTTCTGGGATTGGTTTGATGATCGAACATGG
CATCCCCTCGGCCGCGTCACGGGCGGCACGCTGTACCCTGGTCTGATGGTGACGAGCGGCATCATCTATCACGCC
CTCCGCGCCATAGCCATTCCAGTCGATATCCGCAACGTCTGCGTTCTCCTCGCACCGGCCTTTTCTGGCCTGACG
GCGTATGCTGCCTATCTGCTGACCAATGAGCTGACCACTCTGCCGTCTGCTGGCCTCTTGGCGGCCATCTTCATG
GGCATCGCCCCCGGCTACATCTCCAGGTCGGTTGCGGGCAGCTACGATAACGAAGCCATTGCCATCTTCCTCCTC
GTCTTCACCTTTTACCTGTGGATAAAGGCCCTCAAACTGGGATCCATGCTCTGGAGCGTCTTCTGTGCCCTCTCT
TACGGCTACATGGTTGCATCGTGGGGCGGCTACGCTTTCATCACCTGCCTCTTGCCTCTTCATACCTTTGTCCTC
ATCTGCATGGGAAGATATAGCCCCCGACTCTACGTCAGCTACTGCACGTGGTACGCCCTCGGCACCCTGGCCAGC
ATGCAGATCCCTTTCGTCGGCTTCCTCCCCGTCAAGACGAGCGAGCACATGCCGGCTCTGGGTATGATACCTCGC
GTGGAGGAGTGGTTCGTCCACGCTAACCTGGCCTCGCTAGGCATCTTTGGCTTTATTCAACTCATCGCGTTTATC
GATTATGTCAAAGCTGCCATTCCCTCCCGCCAGTTCCAGACCTTTGTCGTCACCATCCTGGTTGCTGCCTTTGGT
GTCGGCCTGCTGGCACTCGTGGCTCTCACTTCTCTGGGCTACGTCGCCCCCTGGAGCGGCCGTTTCTATTCTCTC
TGGGACACGGGCTACGCCAAGATACACATCCCCATCATCGCCTCCGTATCGGAGCATCAGCCGCCGGCCTGGCCT
GCTTTTTTCTTTGACCTCAACATGCTCATCTGGTTGTTCCCGGCAGGCATCTACCTGTGCTTCCAGGAGCTTCGG
GACGAGCACGTCTTTGTCATCGTCTACGGCCTCTTTGGCAGCTACTTCGCCGGCGTCATGGTTCGACTGATGCTC
ACGCTGACGCCCATTGTCTGCGTCACGGCTGCCATTGCCATGTCTCAGCTCATCGACATCTTTATTCGTCCCAAG
GCCAACCCGGTGGATGAAATGCAGAGCACGGGCGAGGCAACGACCAAGAAGAACGTCAAGAGCGGCGGCCTCCGC
GGCAGCGAGAAGCCGCTTCTCGGAATCTTCAGCTCGATCCCGCGGGTGGCTGTCATCTCGATAGTGCTGGTCTAT
CTGCTCATGTTCGTGAGCCACTGCACTTGGGTGACGTCCAACGCCTACTCGTCGCCGTCGGTGGTCCTGGCTAGC
CGGATGCCCGACGGCTCGCAGCACATCATCGACGACTACAGGGAGGCGTACCAGTGGCTCCGACAGAATACCAAG
GAGAATGCCAAGATCATGTCGTGGTGGGACTACGGCTACCAGATTGGCGGCATGGCGGACCGACCGACGCTGGTG
GACAACAATACGTGGAACAACACGCACATTGCCATTGTGGGCAAGGCCATGGCGTCGCGAGAGGAGGTCAGCTAC
GAGATCATGCGACAGCACGAGGTCGACTACGTCCTCGTCGTCTTTGGCGGCCTTTTGGGCTACTCGGGAGACGAT
ATCAACAAGTTCCTCTGGATGGTGCGAATCGCCGAGGGCATCTGGCCGGAAGAGATCAGGGAGCGCGACTTTTTC
ACAGCCCGCGGCGAGTACCGCGTCGACGGCGAGGCGACGGATGCGATGAAGAACAGCTTGATGTACAAGATGTGC
TACTACAACTACCACTCGCTGTTCCCGCCCGGCCAGGTCGTCGACCGTGTCCGCGGCGTTCGGATGCCGGATAAG
GGCCCTACTCTGGACGTGGTGGAAGAGGCGTTTACCAGCGAGAACTGGATCATCCGCATCTACAAGGTCAAGGAT
CTGGACATACTCGGTCGCGACCACGCCGCTGTGGCCGCTTTTGAGCGGGGAGAGAAGCGAAAGAAGGCCAAGAGG
AAAGGGCCGCGCATGCTCCGAGACCCGTAG
Gene >Ophun1|2926
ATGCCTCCCGTGGCAGATCAAGCCCAGCTTCGCGCTGCGGGATCAAAGTCTCAAAGCACCCAGGCTCTTCTCAAA
GTTGTCATTCTGTGCCTCATCGCAATCACCGCCGTTGCCAGTCGCCTCTTCTCTGTCATCCGTAAGTGACGCGTT
TGATTCCTGTTTTTCCATCATGTTTTTTTTCTTTCGTTTCACCGTTTGCTAACTTGATGGACGATAGGTTTCGAG
AGCATCATCCACGAATGTACGTGTCTTCCCCCAAAGCTTTCCTCGTCTCGTGCCCCGACGTGAGCACCGTTCCTT
GCTGACTGCGAGCAGTTGATCCTTGGTTTAATTTCAGAGCAACAAAGTATCTCGTTAACAACGGATTCTACAAGT
TCTGGGATTGGTTTGATGATCGAACATGGCATCCCCTCGGCCGCGTCACGGGCGGCACGCTGTACCCTGGTCTGA
TGGTGACGAGCGGCATCATCTATCACGCCCTCCGCGCCATAGCCATTCCAGTCGATATCCGCAACGTCTGCGTTC
TCCTCGCACCGGCCTTTTCTGGCCTGACGGCGTATGCTGCCTATCTGCTGACCAATGAGCTGACCACTCTGCCGT
CTGCTGGCCTCTTGGCGGCCATCTTCATGGGCATCGCCCCCGGCTACATCTCCAGGTCGGTTGCGGGCAGCTACG
ATAACGAAGCCATTGCCATCTTCCTCCTCGTCTTCACCTTTTACCTGTGGATAAAGGCCCTCAAACTGGGATCCA
TGCTCTGGAGCGTCTTCTGTGCCCTCTCTTACGGCTACATGGTTGCATCGTGGGGCGGCTACGCTTTCATCACCT
GCCTCTTGCCTCTTCATACCTTTGTCCTCATCTGCATGGGAAGATATAGCCCCCGACTCTACGTCAGCTACTGCA
CGTGGTACGCCCTCGGCACCCTGGCCAGCATGCAGATCCCTTTCGTCGGCTTCCTCCCCGTCAAGACGAGCGAGC
ACATGCCGGCTCTGGGTATGATACCTCGCGTGGAGGAGTGGTTCGTCCACGCTAACCTGGCCTCGCTAGGCATCT
TTGGCTTTATTCAACTCATCGCGTTTATCGATTATGTCAAAGCTGCCATTCCCTCCCGCCAGTTCCAGACCTTTG
TCGTCACCATCCTGGTTGCTGCCTTTGGTGTCGGCCTGCTGGCACTCGTGGCTCTCACTTCTCTGGGCTACGTCG
CCCCCTGGAGCGGCCGTTTCTATTCTCTCTGGGACACGGGCTACGCCAAGATACACATCCCCATCATCGCCTCCG
TATCGGAGCATCAGCCGCCGGCCTGGCCTGCTTTTTTCTTTGACCTCAACATGCTCATCTGGTTGTTCCCGGCAG
GCATCTACCTGTGCTTCCAGGAGCTTCGGGACGAGCACGTCTTTGTCATCGTCTACGGCCTCTTTGGCAGCTACT
TCGCCGGCGTCATGGTTCGACTGATGCTCACGCTGACGCCCATTGTCTGCGTCACGGCTGCCATTGCCATGTCTC
AGCTCATCGACATCTTTATTCGTCCCAAGGCCAACCCGGTGGATGAAATGCAGAGCACGGGCGAGGCAACGACCA
AGAAGAACGTCAAGAGCGGCGGCCTCCGCGGCAGCGAGAAGCCGCTTCTCGGAATCTTCAGCTCGATCCCGCGGG
TGGCTGTCATCTCGATAGTGCTGGTCTATCTGCTCATGTTCGTGAGCCACTGCACTTGGGTGACGTCCAACGCCT
ACTCGTCGCCGTCGGTGGTCCTGGCTAGCCGGATGCCCGACGGCTCGCAGCACATCATCGACGACTACAGGGAGG
CGTACCAGTGGCTCCGACAGAATACCAAGGAGAATGCCAAGATCATGTCGTGGTGGGACTACGGCTACCAGATTG
GCGGCATGGCGGACCGACCGACGCTGGTGGACAACAATACGTGGAACAACACGCACATTGCCATTGTGGGCAAGG
CCATGGCGTCGCGAGAGGAGGTCAGCTACGAGATCATGCGACAGCACGAGGTCGACTACGTCCTCGTCGTCTTTG
GCGGCCTTTTGGGCTACTCGGGAGACGATATCAACAAGTTCCTCTGGATGGTGCGAATCGCCGAGGGCATCTGGC
CGGAAGAGATCAGGGAGCGCGACTTTTTCACAGCCCGCGGCGAGTACCGCGTCGACGGCGAGGCGACGGATGCGA
TGAAGAACAGCTTGATGTGAGTTGAGGCTTGTGACTGATGAGATGACCATGGTAGCTGACGTTCTGGCCAGGTAC
AAGATGTGCTACTACAACTACCACTCGCTGTTCCCGCCCGGCCAGGTCGTCGACCGTGTCCGCGGCGTTCGGATG
CCGGATAAGGGCCCTACTCTGGACGTGGTGGAAGAGGCGTTTACCAGCGAGAACTGGATCATCCGCATCTACAAG
GTCAAGGATCTGGACATACTCGGTCGCGACCACGCCGCTGTGGCCGCTTTTGAGCGGGGAGAGAAGCGAAAGAAG
GCCAAGAGGAAAGGGCCGCGCATGCTCCGAGACCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail