Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2896
Gene name
LocationContig_259:171..1227
Strand+
Gene length (bp)1056
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07228 SpoIIE Stage II sporulation protein E (SpoIIE) 5.9E-11 81 240
PF13672 PP2C_2 Protein phosphatase 2C 6.5E-08 69 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09189|AZR1_SCHPO 5-azacytidine resistance protein azr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=azr1 PE=3 SV=3 3 343 4.0E-37
sp|P38797|PP2C7_YEAST Protein phosphatase 2C homolog 7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC7 PE=1 SV=2 60 336 1.0E-32
sp|B4JYN1|PTC71_DROGR Protein phosphatase PTC7 homolog fig OS=Drosophila grimshawi GN=fig PE=3 SV=1 68 337 3.0E-31
sp|B4NBL6|PTC71_DROWI Protein phosphatase PTC7 homolog fig OS=Drosophila willistoni GN=fig PE=3 SV=1 68 343 2.0E-30
sp|B3P5D3|PTC71_DROER Protein phosphatase PTC7 homolog fig OS=Drosophila erecta GN=fig PE=3 SV=1 68 337 1.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09189|AZR1_SCHPO 5-azacytidine resistance protein azr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=azr1 PE=3 SV=3 3 343 4.0E-37
sp|P38797|PP2C7_YEAST Protein phosphatase 2C homolog 7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC7 PE=1 SV=2 60 336 1.0E-32
sp|B4JYN1|PTC71_DROGR Protein phosphatase PTC7 homolog fig OS=Drosophila grimshawi GN=fig PE=3 SV=1 68 337 3.0E-31
sp|B4NBL6|PTC71_DROWI Protein phosphatase PTC7 homolog fig OS=Drosophila willistoni GN=fig PE=3 SV=1 68 343 2.0E-30
sp|B3P5D3|PTC71_DROER Protein phosphatase PTC7 homolog fig OS=Drosophila erecta GN=fig PE=3 SV=1 68 337 1.0E-29
sp|B4PPK3|PTC71_DROYA Protein phosphatase PTC7 homolog fig OS=Drosophila yakuba GN=fig PE=3 SV=1 68 337 1.0E-29
sp|B3MTI8|PTC71_DROAN Protein phosphatase PTC7 homolog fig OS=Drosophila ananassae GN=fig PE=3 SV=1 56 337 2.0E-29
sp|Q29AP0|PTC71_DROPS Protein phosphatase PTC7 homolog fig OS=Drosophila pseudoobscura pseudoobscura GN=fig PE=3 SV=2 56 337 4.0E-29
sp|B4HZE7|PTC71_DROSE Protein phosphatase PTC7 homolog fig OS=Drosophila sechellia GN=fig PE=3 SV=1 57 337 9.0E-29
sp|B4R089|PTC71_DROSI Protein phosphatase PTC7 homolog fig OS=Drosophila simulans GN=fig PE=3 SV=1 57 337 2.0E-28
sp|B4K616|PTC71_DROMO Protein phosphatase PTC7 homolog fig OS=Drosophila mojavensis GN=fig PE=3 SV=1 68 337 7.0E-28
sp|Q9VAH4|PTC71_DROME Protein phosphatase PTC7 homolog fig OS=Drosophila melanogaster GN=fig PE=2 SV=1 57 337 1.0E-27
sp|B4M5T5|PTC71_DROVI Protein phosphatase PTC7 homolog fig OS=Drosophila virilis GN=fig PE=3 SV=1 68 337 3.0E-27
sp|Q5U3N5|PPTC7_DANRE Protein phosphatase PTC7 homolog OS=Danio rerio GN=pptc7 PE=2 SV=1 43 252 1.0E-26
sp|Q6GR25|PPTC7_XENLA Protein phosphatase PTC7 homolog OS=Xenopus laevis GN=pptc7 PE=2 SV=1 68 341 2.0E-26
sp|B4G653|PTC71_DROPE Protein phosphatase PTC7 homolog fig OS=Drosophila persimilis GN=fig PE=3 SV=1 33 337 5.0E-26
sp|Q6NVE9|PPTC7_MOUSE Protein phosphatase PTC7 homolog OS=Mus musculus GN=Pptc7 PE=1 SV=1 68 252 3.0E-25
sp|Q8NI37|PPTC7_HUMAN Protein phosphatase PTC7 homolog OS=Homo sapiens GN=PPTC7 PE=2 SV=1 68 252 5.0E-25
sp|O64730|P2C26_ARATH Probable protein phosphatase 2C 26 OS=Arabidopsis thaliana GN=At2g30170 PE=2 SV=2 66 337 1.0E-22
sp|Q942P9|P2C01_ORYSJ Probable protein phosphatase 2C 1 OS=Oryza sativa subsp. japonica GN=Os01g0164600 PE=2 SV=1 68 337 2.0E-21
sp|Q9LVQ8|P2C80_ARATH Probable protein phosphatase 2C 80 OS=Arabidopsis thaliana GN=At5g66720 PE=2 SV=1 68 337 1.0E-20
sp|Q9SUK9|P2C55_ARATH Probable protein phosphatase 2C 55 OS=Arabidopsis thaliana GN=At4g16580 PE=2 SV=2 68 337 1.0E-17
sp|Q339D2|P2C71_ORYSJ Probable protein phosphatase 2C 71 OS=Oryza sativa subsp. japonica GN=Os10g0370000 PE=2 SV=1 59 253 5.0E-16
sp|Q10QL5|BIP2C_ORYSJ Probable protein phosphatase 2C BIPP2C1 OS=Oryza sativa subsp. japonica GN=BIPP2C1 PE=2 SV=1 68 253 1.0E-15
sp|Q6J2K6|BIP2C_ORYSI Probable protein phosphatase 2C BIPP2C1 OS=Oryza sativa subsp. indica GN=BIPP2C1 PE=2 SV=1 68 253 2.0E-15
sp|Q93V88|P2C62_ARATH Probable protein phosphatase 2C 62 OS=Arabidopsis thaliana GN=At4g33500 PE=2 SV=1 69 249 6.0E-15
sp|Q6H7J4|P2C23_ORYSJ Putative protein phosphatase 2C 23 OS=Oryza sativa subsp. japonica GN=Os02g0633700 PE=5 SV=1 58 344 2.0E-12
sp|Q6H7J3|P2C24_ORYSJ Putative protein phosphatase 2C 24 OS=Oryza sativa subsp. japonica GN=Os02g0633900 PE=3 SV=1 65 337 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0004721 phosphoprotein phosphatase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup595
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1435
Ophiocordyceps australis map64 (Brazil) OphauB2|6039
Ophiocordyceps camponoti-floridani Ophcf2|01633
Ophiocordyceps camponoti-floridani Ophcf2|06403
Ophiocordyceps camponoti-rufipedis Ophun1|2896 (this protein)
Ophiocordyceps kimflemingae Ophio5|6404
Ophiocordyceps kimflemingae Ophio5|7440
Ophiocordyceps subramaniannii Hirsu2|7547

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2896
MATSLAQRVVARARVAGHLARYSTTSSPSLGIHLAASFSAKDRPYDPSSHVFSFGSPSSKSATRPESGHDAFFVR
RVGGSDAVAFGVADGVGGWTESGVDPADFSHGLCRYMADAAGSDLSKPRPVTARKLMEAGYDAVCRDKSLVAGGS
TACVAVASSDGVVDVANLGDSGYLQLRLNAVNAVSAPQTHAFNTPYQLSLLPPHMVAGFTDLPRDADVSQHQLRH
GDVLLLATDGLLDNLFHQDILRIISRVMVVTGAWSLTSSKRICVADTLANLVTSSPAGSPLQVLLATELVAAAKA
ASINTRIDGPFAKEVKRYYPRERWHGGKIDDICVIVAVACEKNSTSREAES*
Coding >Ophun1|2896
ATGGCTACGAGCCTCGCTCAACGCGTCGTAGCTCGTGCCAGAGTCGCCGGCCATCTCGCTCGCTACTCGACCACG
TCATCGCCCAGCCTCGGCATCCACCTGGCCGCCTCGTTCAGCGCAAAGGACCGACCTTACGACCCGTCTTCTCAC
GTCTTCAGCTTCGGCAGCCCGAGCAGCAAGTCGGCGACGCGGCCCGAGTCCGGTCACGATGCCTTCTTTGTCCGT
CGCGTTGGCGGCTCCGATGCCGTGGCCTTTGGTGTTGCGGACGGCGTTGGCGGCTGGACGGAGTCGGGCGTCGAT
CCGGCCGACTTCTCCCACGGCCTGTGCCGATACATGGCCGATGCTGCCGGCTCCGACTTGTCCAAGCCACGCCCG
GTGACGGCCCGCAAGCTCATGGAGGCTGGTTACGACGCCGTGTGCCGCGATAAGAGCCTCGTCGCCGGTGGCAGC
ACCGCTTGCGTTGCCGTCGCCTCGTCCGATGGCGTCGTCGACGTGGCCAATCTCGGCGACTCGGGTTATCTGCAG
CTGCGTCTCAATGCCGTCAATGCCGTCTCGGCGCCACAGACGCACGCCTTCAATACGCCCTACCAACTTTCGCTG
CTGCCTCCCCACATGGTCGCCGGCTTCACGGACCTTCCACGAGACGCCGACGTGTCGCAGCATCAATTGAGACAC
GGCGATGTTCTGCTGCTGGCTACGGATGGTCTGTTGGACAACTTGTTTCATCAAGATATTCTCCGCATCATCAGT
CGCGTCATGGTCGTGACCGGCGCCTGGTCCTTGACGTCTTCGAAGCGCATCTGCGTCGCCGACACCCTCGCCAAC
CTGGTCACGAGCTCGCCTGCCGGATCTCCACTACAGGTTCTACTGGCCACTGAGCTCGTGGCGGCGGCCAAGGCG
GCGAGCATCAATACCAGGATTGACGGGCCCTTTGCCAAGGAGGTCAAGAGGTACTACCCTCGGGAACGATGGCAT
GGAGGCAAGATAGACGATATATGTGTCATCGTCGCCGTCGCCTGCGAGAAGAATTCAACGAGTCGGGAAGCAGAG
TCTTGA
Transcript >Ophun1|2896
ATGGCTACGAGCCTCGCTCAACGCGTCGTAGCTCGTGCCAGAGTCGCCGGCCATCTCGCTCGCTACTCGACCACG
TCATCGCCCAGCCTCGGCATCCACCTGGCCGCCTCGTTCAGCGCAAAGGACCGACCTTACGACCCGTCTTCTCAC
GTCTTCAGCTTCGGCAGCCCGAGCAGCAAGTCGGCGACGCGGCCCGAGTCCGGTCACGATGCCTTCTTTGTCCGT
CGCGTTGGCGGCTCCGATGCCGTGGCCTTTGGTGTTGCGGACGGCGTTGGCGGCTGGACGGAGTCGGGCGTCGAT
CCGGCCGACTTCTCCCACGGCCTGTGCCGATACATGGCCGATGCTGCCGGCTCCGACTTGTCCAAGCCACGCCCG
GTGACGGCCCGCAAGCTCATGGAGGCTGGTTACGACGCCGTGTGCCGCGATAAGAGCCTCGTCGCCGGTGGCAGC
ACCGCTTGCGTTGCCGTCGCCTCGTCCGATGGCGTCGTCGACGTGGCCAATCTCGGCGACTCGGGTTATCTGCAG
CTGCGTCTCAATGCCGTCAATGCCGTCTCGGCGCCACAGACGCACGCCTTCAATACGCCCTACCAACTTTCGCTG
CTGCCTCCCCACATGGTCGCCGGCTTCACGGACCTTCCACGAGACGCCGACGTGTCGCAGCATCAATTGAGACAC
GGCGATGTTCTGCTGCTGGCTACGGATGGTCTGTTGGACAACTTGTTTCATCAAGATATTCTCCGCATCATCAGT
CGCGTCATGGTCGTGACCGGCGCCTGGTCCTTGACGTCTTCGAAGCGCATCTGCGTCGCCGACACCCTCGCCAAC
CTGGTCACGAGCTCGCCTGCCGGATCTCCACTACAGGTTCTACTGGCCACTGAGCTCGTGGCGGCGGCCAAGGCG
GCGAGCATCAATACCAGGATTGACGGGCCCTTTGCCAAGGAGGTCAAGAGGTACTACCCTCGGGAACGATGGCAT
GGAGGCAAGATAGACGATATATGTGTCATCGTCGCCGTCGCCTGCGAGAAGAATTCAACGAGTCGGGAAGCAGAG
TCTTGA
Gene >Ophun1|2896
ATGGCTACGAGCCTCGCTCAACGCGTCGTAGCTCGTGCCAGAGTCGCCGGCCATCTCGCTCGCTACTCGACCACG
TCATCGCCCAGCCTCGGCATCCACCTGGCCGCCTCGTTCAGCGCAAAGGACCGACCTTACGACCCGTCTTCTCAC
GTCTTCAGCTTCGGCAGCCCGAGCAGCAAGTCGGCGACGCGGCCCGAGTCCGGTCACGATGCCTTCTTTGTCCGT
CGCGTTGGCGGCTCCGATGCCGTGGCCTTTGGTGTTGCGGACGGCGTTGGCGGCTGGACGGAGTCGGGCGTCGAT
CCGGCCGACTTCTCCCACGGCCTGTGCCGATACATGGCCGATGCTGCCGGCTCCGACTTGTCCAAGCCACGCCCG
GTGACGGCCCGCAAGCTCATGGAGGCTGGTTACGACGCCGTGTGCCGCGATAAGAGCCTCGTCGCCGGTGGCAGC
ACCGCTTGCGTTGCCGTCGCCTCGTCCGATGGCGTCGTCGACGTGGCCAATCTCGGCGACTCGGGTTATCTGCAG
CTGCGTCTCAATGCCGTCAATGCCGTCTCGGCGCCACAGACGCACGCCTTCAATACGCCCTACCAACTTTCGCTG
CTGCCTCCCCACATGGTCGCCGGCTTCACGGACCTTCCACGAGACGCCGACGTGTCGCAGCATCAATTGAGACAC
GGCGATGTTCTGCTGCTGGCTACGGATGGTCTGTTGGACAACTTGTTTCATCAAGATATTCTCCGCATCATCAGT
CGCGTCATGGTCGTGACCGGCGCCTGGTCCTTGACGTCTTCGAAGCGCATCTGCGTCGCCGACACCCTCGCCAAC
CTGGTCACGAGCTCGCCTGCCGGATCTCCACTACAGGTTCTACTGGCCACTGAGCTCGTGGCGGCGGCCAAGGCG
GCGAGCATCAATACCAGGATTGACGGGCCCTTTGCCAAGGAGGTCAAGAGGTACTACCCTCGGGAACGATGGCAT
GGAGGCAAGATAGACGATATATGTGTCATCGTCGCCGTCGCCTGCGAGAAGAATTCAACGAGTCGGGAAGCAGAG
TCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail