Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2886
Gene name
LocationContig_258:982..4320
Strand-
Gene length (bp)3338
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 6.7E-53 22 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 11 464 1.0E-85
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 11 455 8.0E-83
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 11 457 7.0E-82
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 11 457 3.0E-81
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 11 451 2.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 11 464 1.0E-85
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 11 455 8.0E-83
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 11 457 7.0E-82
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 11 457 3.0E-81
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 11 451 2.0E-60
sp|Q04121|NHX1_YEAST Endosomal/prevacuolar sodium/hydrogen exchanger OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHX1 PE=1 SV=1 45 310 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0006812 cation transport Yes
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0015297 antiporter activity No
GO:0015298 solute:cation antiporter activity No
GO:0022857 transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 45 64 19
3 121 143 22
4 148 170 22
5 197 219 22
6 229 251 22
7 271 290 19
8 342 364 22
9 385 407 22
10 437 459 22
11 472 494 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2886
MAQKKVWAIPLELSNYNVIVALLGGFISLFGLVSFLLKENFYLSESLISLLAGLAFGPLGANLIRPGAYVQCDDT
AVSDARCEASLDHITLNFSRLVLAVQLVLAGVQLPRKYLWREWKPILLLIGPGMTCMWLATSLLVWGLADAPGIL
QALAIGACVTPTDPVLSAVIIKGKFANENVPKDLQDLVVAESGANDGLGYPFLFLALYLIKFLGPTASSGGVREA
MGLWFAITWSYTILLSIVFGAVVGYLAKELLRWAQERGYVDREAFTVFSIALALFVFGTCGLIGTDDLLACFIAG
NAFTWDDWFRVQTLDDSLQPTMDMLLNVSIFLWYGASLPWNLFSQNSVISTGRLIALGLLVLLLRRLPWIYCLHW
WIPQLRNAKRAVFVGFFGPMGVSAVFYLLISLNFIDDHLSDETGQPRSDVKNFGELMRVVVWFLVVCSTLVHGLS
IPLGRVGYVAPKRIMHVFKRRVLVGLAGLVAFAVAEPATVGNVTEIPTDEEITIACESPNKPNTLRPDYLGIFYS
LTEYRGDNLTFGFEDKKRCVNLEPPFIEDGKNNHPSRSIRIGCATYDHCTMYQHFNCKGSERTYGKNKGNVKAHR
GIKSIRCKQWHNPSSSGDS*
Coding >Ophun1|2886
ATGGCGCAAAAAAAGGTTTGGGCGATCCCGCTCGAGTTGTCCAACTACAACGTCATCGTCGCCCTGCTCGGTGGC
TTCATCTCGCTGTTCGGATTGGTGTCTTTTCTATTAAAGGAGAATTTCTATCTTTCCGAGTCCCTCATCTCTCTC
CTGGCGGGTCTCGCCTTCGGGCCGCTGGGTGCAAACTTGATACGACCGGGAGCCTATGTCCAGTGCGATGATACG
GCCGTCTCGGACGCCAGATGCGAGGCCAGCCTGGATCACATCACGCTCAATTTTTCTCGCCTTGTTCTCGCTGTT
CAGCTTGTCCTGGCGGGAGTTCAGCTCCCTAGGAAATATCTGTGGAGAGAATGGAAGCCCATCTTGTTGCTCATC
GGACCGGGAATGACGTGCATGTGGCTCGCTACGAGCTTGCTAGTCTGGGGCCTTGCAGATGCACCTGGCATACTG
CAGGCGTTGGCTATCGGTGCCTGCGTCACGCCGACGGACCCCGTCCTCTCGGCTGTGATTATCAAGGGCAAGTTT
GCCAACGAGAATGTTCCCAAGGACCTTCAGGATCTCGTCGTCGCGGAATCGGGGGCAAATGATGGGCTCGGCTAC
CCATTCTTGTTTCTCGCCCTGTATCTCATCAAGTTTCTCGGCCCGACGGCTTCGTCTGGCGGCGTGAGAGAGGCC
ATGGGTCTCTGGTTCGCGATAACGTGGTCGTATACGATTCTACTCAGCATCGTCTTTGGCGCAGTGGTGGGTTAT
CTAGCCAAGGAACTGCTCCGCTGGGCTCAAGAACGTGGCTACGTCGACCGCGAAGCCTTTACCGTCTTCTCTATC
GCCCTCGCCCTCTTTGTCTTTGGGACATGCGGCTTGATTGGCACCGACGATCTTCTCGCCTGCTTCATCGCCGGT
AATGCCTTTACGTGGGACGACTGGTTTCGGGTGCAGACGCTGGATGACTCTCTGCAGCCGACGATGGATATGCTG
CTCAACGTATCCATCTTTCTCTGGTACGGGGCGTCACTCCCCTGGAACCTGTTTAGCCAAAACTCGGTTATTTCT
ACTGGCCGTCTCATTGCTCTCGGCCTGCTCGTGCTGCTTCTTCGACGGCTGCCGTGGATCTACTGCCTGCACTGG
TGGATTCCCCAGCTTCGGAACGCGAAAAGGGCTGTCTTTGTCGGCTTCTTTGGTCCTATGGGCGTATCGGCCGTC
TTTTACCTACTCATCTCCCTGAATTTCATCGACGACCATCTGAGCGATGAGACGGGACAGCCTAGGAGCGACGTG
AAGAATTTTGGCGAACTTATGCGTGTTGTCGTCTGGTTTCTAGTCGTCTGTAGTACGTTGGTCCACGGACTCAGC
ATCCCGCTCGGGAGAGTGGGATACGTGGCTCCCAAGAGGATCATGCACGTTTTCAAGCGGAGGGTGCTGGTCGGG
TTGGCTGGCTTGGTGGCCTTTGCGGTCGCTGAACCTGCGACGGTAGGGAATGTGACGGAGATTCCTACGGATGAG
GAGATTACGATTGCGTGCGAAAGTCCGAATAAGCCGAATACTCTGCGGCCAGATTACTTGGGCATCTTTTACAGT
CTTACCGAGTACCGTGGCGATAACCTCACCTTTGGCTTCGAAGATAAGAAGCGTTGCGTCAACCTCGAGCCTCCC
TTCATCGAGGACGGGAAGAACAACCACCCTTCGCGCTCAATCCGCATCGGCTGCGCGACGTACGACCACTGCACC
ATGTATCAACATTTCAACTGCAAGGGCTCGGAGCGCACCTACGGGAAGAACAAGGGGAATGTCAAGGCCCATCGC
GGCATCAAGTCTATCCGCTGCAAGCAGTGGCATAACCCGAGTTCGTCGGGGGATAGCTAG
Transcript >Ophun1|2886
ATGGCGCAAAAAAAGGTTTGGGCGATCCCGCTCGAGTTGTCCAACTACAACGTCATCGTCGCCCTGCTCGGTGGC
TTCATCTCGCTGTTCGGATTGGTGTCTTTTCTATTAAAGGAGAATTTCTATCTTTCCGAGTCCCTCATCTCTCTC
CTGGCGGGTCTCGCCTTCGGGCCGCTGGGTGCAAACTTGATACGACCGGGAGCCTATGTCCAGTGCGATGATACG
GCCGTCTCGGACGCCAGATGCGAGGCCAGCCTGGATCACATCACGCTCAATTTTTCTCGCCTTGTTCTCGCTGTT
CAGCTTGTCCTGGCGGGAGTTCAGCTCCCTAGGAAATATCTGTGGAGAGAATGGAAGCCCATCTTGTTGCTCATC
GGACCGGGAATGACGTGCATGTGGCTCGCTACGAGCTTGCTAGTCTGGGGCCTTGCAGATGCACCTGGCATACTG
CAGGCGTTGGCTATCGGTGCCTGCGTCACGCCGACGGACCCCGTCCTCTCGGCTGTGATTATCAAGGGCAAGTTT
GCCAACGAGAATGTTCCCAAGGACCTTCAGGATCTCGTCGTCGCGGAATCGGGGGCAAATGATGGGCTCGGCTAC
CCATTCTTGTTTCTCGCCCTGTATCTCATCAAGTTTCTCGGCCCGACGGCTTCGTCTGGCGGCGTGAGAGAGGCC
ATGGGTCTCTGGTTCGCGATAACGTGGTCGTATACGATTCTACTCAGCATCGTCTTTGGCGCAGTGGTGGGTTAT
CTAGCCAAGGAACTGCTCCGCTGGGCTCAAGAACGTGGCTACGTCGACCGCGAAGCCTTTACCGTCTTCTCTATC
GCCCTCGCCCTCTTTGTCTTTGGGACATGCGGCTTGATTGGCACCGACGATCTTCTCGCCTGCTTCATCGCCGGT
AATGCCTTTACGTGGGACGACTGGTTTCGGGTGCAGACGCTGGATGACTCTCTGCAGCCGACGATGGATATGCTG
CTCAACGTATCCATCTTTCTCTGGTACGGGGCGTCACTCCCCTGGAACCTGTTTAGCCAAAACTCGGTTATTTCT
ACTGGCCGTCTCATTGCTCTCGGCCTGCTCGTGCTGCTTCTTCGACGGCTGCCGTGGATCTACTGCCTGCACTGG
TGGATTCCCCAGCTTCGGAACGCGAAAAGGGCTGTCTTTGTCGGCTTCTTTGGTCCTATGGGCGTATCGGCCGTC
TTTTACCTACTCATCTCCCTGAATTTCATCGACGACCATCTGAGCGATGAGACGGGACAGCCTAGGAGCGACGTG
AAGAATTTTGGCGAACTTATGCGTGTTGTCGTCTGGTTTCTAGTCGTCTGTAGTACGTTGGTCCACGGACTCAGC
ATCCCGCTCGGGAGAGTGGGATACGTGGCTCCCAAGAGGATCATGCACGTTTTCAAGCGGAGGGTGCTGGTCGGG
TTGGCTGGCTTGGTGGCCTTTGCGGTCGCTGAACCTGCGACGGTAGGGAATGTGACGGAGATTCCTACGGATGAG
GAGATTACGATTGCGTGCGAAAGTCCGAATAAGCCGAATACTCTGCGGCCAGATTACTTGGGCATCTTTTACAGT
CTTACCGAGTACCGTGGCGATAACCTCACCTTTGGCTTCGAAGATAAGAAGCGTTGCGTCAACCTCGAGCCTCCC
TTCATCGAGGACGGGAAGAACAACCACCCTTCGCGCTCAATCCGCATCGGCTGCGCGACGTACGACCACTGCACC
ATGTATCAACATTTCAACTGCAAGGGCTCGGAGCGCACCTACGGGAAGAACAAGGGGAATGTCAAGGCCCATCGC
GGCATCAAGTCTATCCGCTGCAAGCAGTGGCATAACCCGAGTTCGTCGGGGGATAGCTAG
Gene >Ophun1|2886
ATGGCGCAAAAAAAGGTTTGGGCGATCCCGCTCGAGTTGTCCAACTACAACGTCATCGTCGCCCTGCTCGGTGGC
TTCATCTCGCTGTTCGGATTGGTGTCTTTTCTATTAAAGGAGAATTTCTATCTTTCCGAGTCCCGTAAGTCTGCA
ACGTCTCGATGCAACGTCGGCGGCCAATCACCTCCGACCTCGCACCTACAATGTGCATGTTGCTGAGCTCCGCGT
TGCAGTCATCTCTCTCCTGGCGGGTCTCGCCTTCGGGCCGCTGGGTGCAAACTTGATACGACCGGGAGCCTATGT
CCAGTGCGATGATACGGCCGTCTCGGACGCCAGATGCGAGGCCAGCCTGGATCACATCACGCTCAATTTTTCTCG
CCTTGTTCTCGCTGTTCAGCTTGTCCTGGCGGGAGTTCAGCTCCCTAGGAAATATCTGTGGAGAGAATGGAAGCC
CATCTTGTTGCTCATCGGACCGGGAATGACGTGCATGTGGCTCGCTACGAGCTTGCTAGTCTGGGGCCTTGCAGA
TGCACCTGGCATACTGCAGGCGTTGGCTATCGGTGCCTGCGTCACGCCGACGGACCCCGTCCTCTCGGCTGTGAT
TATCAAGGGCAAGTTTGCCAACGAGAATGTTCCCAAGGACCTTCAGGATCTCGTCGTCGCGGAATCGGGGGCAAA
TGATGGGCTCGGCTACCCATTCTTGTTTCTCGCCCTGTATCTCATCAAGTTTCTCGGCCCGACGGCTTCGTCTGG
CGGCGTGAGAGAGGCCATGGGTCTCTGGTTCGCGATAACGTGGTCGTATACGATTCTACTCAGCATCGTCTTTGG
CGCAGTGGTGGGTTATCTAGCCAAGGAACTGCTCCGCTGGGCTCAAGAACGTGGCTACGTCGACCGCGAAGCCTT
TACCGTCTTCTCTATCGCCCTCGCCCTCTTTGTCTTTGGGACATGCGGCTTGATTGGCACCGACGATCTTCTCGC
CTGCTTCATCGCCGGTAATGCCTTTACGTGGGACGACTGGTTTCGGGTGCAGACGCTGGATGACTCTCTGCAGCC
GACGATGGATATGCTGCTCAACGTATCCATCTTTCTCTGGTACGGGGCGTCACTCCCCTGGAACCTGTTTAGCCA
AAACTCGGTTATTTCTACTGGCCGTCTCATTGCTCTCGGCCTGCTCGTGCTGCTTCTTCGACGGCTGCCGTGGAT
CTACTGCCTGCACTGGTGGATTCCCCAGCTTCGGAACGCGAAAAGGGCTGTCTTTGTCGGCTTCTTTGGTCCTAT
GGGCGTATCGGCCGTCTTTTACCTACTCATCTCCCTGAATTTCATCGACGACCATCTGAGCGATGAGACGGGACA
GCCTAGGAGCGACGTGAAGAATTTTGGCGAACTTATGCGTGTTGTCGTCTGGTTTCTAGTCGTCTGTAGTACGGT
GAGTGATTCTTTCGCGTGGTTTACCCCCCTTTTCATTCATGCTGGCGCTCGGTTAACATTGAAGCGTGATAGTTG
GTCCACGGACTCAGCATCCCGCTCGGGAGAGTGGGATACGTGGCTCCCAAGAGGATCATGCACGTTTTCAAGCGG
AGGTCAAGCGATGGGCCGCTAAGGACCGAGGCTCGAAGTAAGATACCCGTCATCGGGAGATATATAAGCAGAAGC
TCGAGTGTGAGGGTTGATGCTAGGCGTCCCTGGACGGCGTTGGAGCTTCGCATGTTGCGTCCGGTTCATTGGGGC
CCTGAGCGCCCGACTCGGACGGTTGACGGCTCGACGGATGGGTCGGGGTCTGCGACGCCAATTTGGCGACAGAGT
GGAAGTCGGGCTTCTGATGAGACTCGGGTTGGGAGTGGTGATTGAAAGGTACGAAGGAAAGAATGAATGATGTGA
TGATGATGAGGGATGACGAGGAGGAAAAGGTAAATGAATGGATAACTGAATGACGAGCGAGGGTTGACCTGAGAG
AATGGAAAGGTATGTAACCACAAAGACGCATGTGGGCATTCAACTTACAGCATGGCTTAGAATAACTTTGTTGTC
GTTGATCTGGCCGCTAGAGCCAAAAGCGTCTTCAGTGTTCAGCCGGCCACGAACAGCAAGATGAGGCATAGCGCC
GCTATCGAATACAGGGGCCGGACTCAACATCATGGTGCTAACCAGCACTTGCTTCCGCAACGAGCGCCAACGTCT
GCATTTTGCAACTGGTTGACGTCCCGGGCGTACCGGTCGCCGAGGCTGAGCCTCTGTCTTGACTTTTCGGAGCCG
GGCCGAACTCGGTCGGTGTATATCCGGCTTTGTAAGAAGGACAGTCCGCAGAATCCGCAGCCTTGTTCTCGACAA
TCGAGCCCTGCTATCCTGTTGTCGTCCGTCTTGTTCTGGACAATCAAGCCCTGCCATCATGTTGTCGTCACCGCG
TGGCAACGTATCGAGGTTGCTTTCACCTCTAGCCGCGATCAGGCTCCGAAGCCGTCGACAAGCCGGCCTCGTCCA
AAGAAGCCAAAGTGAAAATAACCGCCCAAGCTAGGCAACGTCGAAGCCTCCACCCCGTTGGGGACTGGCGGGTGT
CCGGGCCCGTTATATCAAGAACGACGCCGTTCGCTCTGCAATCCAGGCTGCACGGTTTTGAGATTCTCCCCTTGT
TCGTACTCGGTTATCTCTTGTTTCTTTCTAAGAGGACTGCTTTCACAATGTTGCCCAGGGTGCTGGTCGGGTTGG
CTGGCTTGGTGGCCTTTGCGGTCGCTGAACCTGCGACGGTAGGGAATGTGACGGAGATTCCTACGGATGAGGAGA
TTACGATTGCGTGCGAAAGTCCGAATAAGCCGAATACTCTGCGGCCAGATTACTTGGTATGTCAACCTTGTGTTT
TTGTCTCGTTCTCGTTGCTCATGCTAGGTGGGATAGGGCATCTTTTACAGTCTTACCGAGTACCGTGGCGATAAC
CTCACCTTTGGCTTCGAAGATAAGAAGCGTTGCGTCAACCTCGAGCCTCCCTTGTACGCTTCCCTTCCCGCTGAG
ATTCTTGACGGCGCTGACGGTGGGCAGCATCGAGGACGGGAAGAACAACCACCCTTCGCGCTCAATCCGCATCGG
CTGCGCGACGTACGACCACTGCACCATGTATCAGTTACGTCTCATGCCTACCCTTGTTTCCGGCCTTGCGCTGAC
GCGGGATTCCTAGACATTTCAACTGCAAGGGCTCGGAGCGCACCTACGGGAAGAACAAGGGGAATGTCAAGGCCC
ATCGCGGCATCAAGTCTATCCGCTGCAAGCAGTGGCATAACCCGAGGTGAGTGCTTGTCTTTTCAGTGGGATGAT
GGGGGCTGACGGGGAGAAGTTCGTCGGGGGATAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail