Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2884
Gene name
LocationContig_257:17248..23330
Strand+
Gene length (bp)6082
Transcript length (bp)4179
Coding sequence length (bp)4179
Protein length (aa) 1393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.6E-73 800 1084
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 4.3E-40 620 789
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 6.1E-34 450 596

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 436 1196 7.0E-124
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 462 1081 8.0E-34
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 499 1156 1.0E-29
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 499 1156 5.0E-29
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 444 1108 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 436 1196 7.0E-124
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 462 1081 8.0E-34
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 499 1156 1.0E-29
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 499 1156 5.0E-29
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 444 1108 2.0E-28
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 459 1119 9.0E-28
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 452 1113 1.0E-27
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 499 1156 4.0E-26
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 453 1090 5.0E-26
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 452 1156 6.0E-25
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 468 1156 9.0E-25
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 440 1081 8.0E-24
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 450 1116 7.0E-23
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 452 1126 3.0E-21
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 499 1157 4.0E-19
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 450 1116 1.0E-18
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 443 1070 6.0E-16
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 452 1081 9.0E-15
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 499 1116 3.0E-12
sp|Q5R826|CSCL1_PONAB CSC1-like protein 1 OS=Pongo abelii GN=TMEM63A PE=2 SV=1 492 1086 7.0E-12
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 485 1081 8.0E-12
sp|O94886|CSCL1_HUMAN CSC1-like protein 1 OS=Homo sapiens GN=TMEM63A PE=1 SV=3 492 1061 6.0E-10
sp|Q8CBX0|CSC1_MOUSE Calcium permeable stress-gated cation channel 1 OS=Mus musculus GN=Tmem63c PE=1 SV=1 498 1067 4.0E-09
sp|Q5T3F8|CSCL2_HUMAN CSC1-like protein 2 OS=Homo sapiens GN=TMEM63B PE=1 SV=1 498 1082 5.0E-09
sp|Q3TWI9|CSCL2_MOUSE CSC1-like protein 2 OS=Mus musculus GN=Tmem63b PE=1 SV=1 498 1082 2.0E-08
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 498 1123 2.0E-06
sp|Q9P1W3|CSC1_HUMAN Calcium permeable stress-gated cation channel 1 OS=Homo sapiens GN=TMEM63C PE=2 SV=1 498 1080 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 445 467 22
2 533 555 22
3 575 597 22
4 805 827 22
5 856 878 22
6 899 921 22
7 1011 1042 31
8 1064 1086 22
9 1090 1112 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2884
MVEAIDRAEGEGAALKTGEIPGTEGLNGAASGPEPGPGRAVEEGGPPGVDVRGGAAKVAAVLESAAASNGDDAAS
PKAASPRAITTPPTAPPAAEPASNQEAKPTAPESSSDPEAAPAPTGEKRKPSPEPADGNGPELKRAKTGDGEDGP
VAAHNGGARKVGRPRKNSKREQRIEDMTHHKHKFKKLLFLPSQPISPFKHHPSNLFTTLATMKTLTILAISAVAH
AGVLVPQCPEKTDAVNCRRICSSADPGAFHSDKVTCTHVKDDGRDAIRCLSNDRFEFDVKVPCKGKEKAPEKAPG
VAGRTKKIEDPAAVPAQSTSTGPANNPSQVPDTTKKDKNTAADAGKGTPNNPVQVPPGCVPISSEQVPSNADESS
SRGKEAQESKTNSNLAGRWAWPSLVRPPWPRLEAAMDLPMLSARDDSPNDASKQLLDLLQNPFRGQIAAVSLPLA
FGISLGTLIFTAICFSFIRPYHQAIYAPKLKHADKKYAPPPLGKKPWAWITPVLQTTEASLVPQIGMDATIFLRF
TRMCRNMFLVLALVGFAILVPVNVANSTVYEGHISDWTMRITPRDVWGQPQWAQVVVAWLFDLIIIGFLWYNYRS
VLRLRRRYFETDEYQNSLHSRTLMLYDLPRQARSDEGIARIIDKVVPNSSFARTVVARNVKILPELIDEHEHAVR
KLEKILAKYLKNPAQLPASRPTCKPSKKDRSLDTYPRGQKLDAIDYYTQRIRDLEIEIKEVRASVDRRGTMPYGF
ASYSDMAEAHAIAHACRGSKPEGATVMLAPKPSDIIWQNMPLSKATRSRRRWINNFWIVVLTFLWVAPNAMMAIF
LVNLSNLGKVWPAFQRNFERNIQFWGMVQGIASPALTSLVYLVLPIIFRRLSVQAGDQTKTGRESHVLARMYSFF
VFNNLIVFSCFSTIWAFVAGVKKRTNSGTNAWEAIEKENMAAAVFLALCENSLFWVTYLLQRELGIAVDLAQLWP
LIQGFFLKKLSSPTPRELIELTAPPAFDYASYYNYFLFYVTVTLCFASIQPLVLPATALFFCFEVYLKKYLILYR
FVTKTESGGLFWRVLFNRFILATILANLVVLLTCWVRGDGTHIQFYAVAPLPLVMMAFKLYCRRAFDDKIRYYST
RLSSKLHDAQLHKEPRLRSEKLSTKFGHPALYRPLITPMVHSKAQNLLPSVYRGRLTDGRGAGGASAGGDDLVSV
SGYSDMYALDAMQQGGKPGQRDKGRLPGFEYVSESHMDFAYYKDRAEFTEQHGGSELYGRPGTPGTDAETQSLSG
RSFSATTVTRTRSPLYGENSGSPLYRQETGGGSPLYPRQDHGGSPLYRQDHGGSPLYSHDNGSSAGLVRNAAAAP
TGPPPLGSFGYSGLAQAEESDPGRTSYFRGGSRPLRPAGEGW*
Coding >Ophun1|2884
ATGGTCGAAGCCATTGATAGAGCGGAGGGGGAGGGCGCGGCGCTGAAGACGGGAGAGATTCCGGGGACGGAGGGT
CTTAACGGTGCGGCTTCGGGGCCGGAGCCGGGGCCGGGGCGTGCGGTTGAGGAGGGGGGGCCGCCGGGGGTGGAT
GTCCGTGGCGGCGCGGCAAAGGTAGCTGCCGTGCTTGAGTCTGCGGCAGCGTCCAACGGCGATGACGCAGCGAGT
CCCAAGGCAGCGAGTCCTCGGGCAATCACCACGCCCCCAACCGCACCGCCGGCCGCCGAACCGGCGTCGAACCAG
GAAGCCAAGCCGACCGCTCCCGAATCATCATCGGATCCCGAGGCAGCGCCAGCCCCAACGGGAGAAAAGCGCAAG
CCGAGTCCCGAGCCAGCAGACGGTAACGGCCCGGAGCTGAAAAGGGCCAAGACGGGCGATGGGGAGGACGGACCC
GTTGCGGCCCACAATGGCGGTGCGCGCAAGGTCGGTCGTCCGCGGAAGAATAGCAAGCGGGAGCAGCGAATCGAG
GACATGACCCATCACAAACACAAGTTTAAGAAGCTGCTCTTCCTGCCTTCCCAACCCATCTCCCCATTCAAACAC
CATCCATCCAACCTGTTCACCACACTCGCCACCATGAAGACCCTGACCATCCTCGCCATCTCGGCCGTCGCCCAC
GCCGGCGTCTTGGTCCCGCAATGCCCCGAGAAAACTGATGCCGTCAACTGCAGACGAATCTGCTCTTCGGCGGAT
CCGGGGGCGTTCCATTCTGATAAGGTGACGTGTACTCATGTCAAGGATGATGGGAGGGATGCCATTCGCTGCTTG
TCGAATGATCGCTTTGAGTTTGATGTCAAGGTTCCTTGTAAGGGGAAGGAGAAGGCTCCGGAGAAGGCTCCGGGG
GTGGCTGGGCGTACGAAAAAGATTGAGGATCCGGCCGCGGTCCCGGCTCAGAGCACATCCACTGGCCCGGCCAAC
AATCCGTCTCAGGTTCCGGATACTACGAAAAAGGACAAGAATACGGCCGCGGACGCTGGCAAGGGCACACCCAAC
AACCCGGTCCAGGTCCCGCCCGGGTGTGTCCCGATTTCCTCGGAACAGGTGCCGTCGAACGCCGATGAAAGCTCC
TCCCGGGGAAAGGAAGCTCAGGAGTCTAAAACCAACAGCAATCTGGCCGGCCGCTGGGCCTGGCCGTCCCTCGTT
CGCCCACCGTGGCCTCGGCTGGAGGCTGCCATGGATCTGCCCATGCTGTCCGCCCGCGATGACTCGCCCAACGAT
GCCAGCAAGCAGCTACTGGACCTGCTCCAGAATCCCTTCCGGGGACAGATCGCGGCCGTCTCCCTCCCCTTGGCC
TTTGGCATCTCGCTCGGCACCCTCATCTTCACCGCCATCTGCTTCTCCTTCATCCGACCCTACCATCAGGCCATC
TACGCCCCCAAGCTCAAGCACGCCGACAAGAAATATGCGCCGCCTCCCCTCGGCAAGAAGCCCTGGGCGTGGATC
ACGCCCGTATTGCAAACGACCGAGGCATCGCTCGTCCCCCAGATCGGCATGGACGCCACCATCTTTTTGCGCTTC
ACCCGCATGTGCCGCAACATGTTTCTCGTCCTCGCCCTCGTCGGCTTTGCCATCCTCGTGCCCGTCAACGTGGCC
AATTCCACCGTCTACGAAGGCCACATCAGCGACTGGACCATGCGAATTACGCCCCGTGACGTCTGGGGCCAGCCG
CAGTGGGCGCAGGTCGTCGTCGCCTGGCTCTTCGACTTGATCATAATCGGCTTCCTGTGGTACAATTACCGGAGT
GTTCTGCGCCTGCGTCGTCGGTACTTTGAGACGGACGAGTATCAGAACAGCCTGCACTCGCGCACCCTCATGCTC
TACGACCTCCCCCGTCAAGCCCGCTCCGACGAGGGCATCGCCCGCATCATCGACAAGGTGGTGCCCAACTCTTCC
TTTGCCCGCACCGTCGTCGCCCGCAACGTCAAGATCCTTCCAGAGCTCATCGACGAGCATGAGCATGCGGTCCGC
AAGCTCGAAAAGATCCTGGCCAAGTACCTGAAAAACCCGGCTCAGCTGCCCGCCTCGAGACCGACGTGCAAGCCG
TCCAAGAAGGATCGGTCGTTGGACACGTACCCGCGCGGCCAGAAGCTCGATGCCATCGACTACTACACGCAGCGC
ATCCGCGACCTCGAGATTGAGATCAAAGAGGTCCGAGCCAGCGTCGACCGGCGCGGAACGATGCCCTACGGCTTC
GCCAGCTACTCGGACATGGCCGAGGCCCACGCCATCGCCCACGCATGTCGCGGCTCCAAGCCCGAGGGCGCGACG
GTGATGCTGGCGCCCAAGCCGTCGGATATCATCTGGCAGAACATGCCGCTATCCAAGGCGACGCGCAGCCGCCGG
CGATGGATTAACAACTTTTGGATCGTCGTCCTCACCTTTCTCTGGGTCGCCCCCAACGCCATGATGGCCATCTTT
CTCGTTAATCTGAGTAACCTCGGCAAGGTCTGGCCTGCCTTCCAGCGCAACTTCGAGCGCAACATCCAATTCTGG
GGCATGGTTCAAGGCATCGCCTCGCCTGCCCTCACCTCGCTCGTCTACCTGGTGCTGCCCATCATCTTCCGCCGC
CTGTCGGTCCAGGCCGGCGACCAGACCAAGACGGGCCGCGAGAGTCACGTCCTGGCCAGGATGTACTCGTTCTTC
GTCTTCAACAACCTCATCGTCTTCTCCTGCTTCAGCACCATCTGGGCTTTTGTCGCCGGCGTCAAGAAGCGGACC
AACAGCGGGACCAACGCCTGGGAAGCCATCGAGAAGGAGAACATGGCCGCCGCCGTCTTCCTCGCCCTTTGCGAG
AATAGCCTGTTCTGGGTCACGTACCTGCTTCAGCGCGAGCTGGGCATCGCCGTCGATCTGGCCCAGCTGTGGCCC
TTGATCCAGGGCTTTTTCCTCAAGAAGCTGTCGAGCCCGACGCCGCGCGAGCTGATTGAGCTGACGGCGCCGCCT
GCCTTTGACTACGCCAGCTACTACAACTACTTTCTCTTCTACGTGACGGTGACGCTGTGCTTCGCCAGCATCCAG
CCCCTGGTGCTACCGGCCACGGCCCTGTTCTTCTGCTTCGAGGTCTACCTCAAGAAGTACCTGATCCTCTACCGC
TTCGTCACCAAGACGGAGTCCGGGGGCCTGTTTTGGCGCGTCCTCTTCAACCGCTTCATCCTGGCCACGATCCTT
GCGAACCTGGTGGTGCTGCTGACGTGCTGGGTCCGCGGCGACGGCACCCATATTCAGTTCTACGCGGTCGCGCCT
CTCCCGCTCGTCATGATGGCCTTTAAGCTGTACTGCCGCCGCGCCTTTGACGACAAGATCCGCTACTACAGCACC
CGCCTGAGTTCCAAGCTGCACGACGCCCAGCTGCACAAGGAGCCGCGGCTCCGCAGCGAGAAGCTGTCGACGAAG
TTCGGCCACCCGGCGCTGTACAGGCCGCTCATCACGCCCATGGTGCATTCCAAGGCCCAGAACCTGCTGCCCTCG
GTCTACAGGGGACGCCTGACGGACGGGAGGGGCGCCGGGGGGGCATCGGCGGGAGGCGACGACCTGGTCAGCGTC
AGCGGCTACTCGGACATGTACGCCCTCGACGCCATGCAGCAGGGCGGGAAGCCGGGGCAGAGGGACAAGGGACGG
CTGCCGGGCTTCGAGTACGTGTCCGAGTCGCACATGGACTTTGCCTACTACAAGGACCGGGCCGAGTTTACCGAA
CAGCACGGGGGCAGCGAGCTGTACGGGAGGCCGGGGACGCCGGGGACCGACGCCGAGACGCAGTCGCTATCGGGC
CGGTCCTTTTCGGCGACGACGGTGACGCGAACCCGCAGTCCGCTGTACGGGGAGAACTCGGGGAGTCCGCTGTAC
CGGCAGGAGACCGGTGGAGGGAGCCCGCTGTACCCGCGGCAGGATCACGGAGGGAGCCCACTGTACCGGCAGGAT
CACGGAGGCAGCCCGCTGTACTCACACGACAACGGCAGCTCGGCGGGTCTGGTGCGCAACGCGGCGGCCGCTCCG
ACGGGACCGCCTCCCCTGGGGTCCTTTGGCTACAGCGGGCTGGCGCAGGCGGAGGAGTCGGACCCGGGGCGGACG
AGCTATTTCCGGGGGGGGAGTCGGCCGTTGAGGCCGGCGGGGGAGGGGTGGTGA
Transcript >Ophun1|2884
ATGGTCGAAGCCATTGATAGAGCGGAGGGGGAGGGCGCGGCGCTGAAGACGGGAGAGATTCCGGGGACGGAGGGT
CTTAACGGTGCGGCTTCGGGGCCGGAGCCGGGGCCGGGGCGTGCGGTTGAGGAGGGGGGGCCGCCGGGGGTGGAT
GTCCGTGGCGGCGCGGCAAAGGTAGCTGCCGTGCTTGAGTCTGCGGCAGCGTCCAACGGCGATGACGCAGCGAGT
CCCAAGGCAGCGAGTCCTCGGGCAATCACCACGCCCCCAACCGCACCGCCGGCCGCCGAACCGGCGTCGAACCAG
GAAGCCAAGCCGACCGCTCCCGAATCATCATCGGATCCCGAGGCAGCGCCAGCCCCAACGGGAGAAAAGCGCAAG
CCGAGTCCCGAGCCAGCAGACGGTAACGGCCCGGAGCTGAAAAGGGCCAAGACGGGCGATGGGGAGGACGGACCC
GTTGCGGCCCACAATGGCGGTGCGCGCAAGGTCGGTCGTCCGCGGAAGAATAGCAAGCGGGAGCAGCGAATCGAG
GACATGACCCATCACAAACACAAGTTTAAGAAGCTGCTCTTCCTGCCTTCCCAACCCATCTCCCCATTCAAACAC
CATCCATCCAACCTGTTCACCACACTCGCCACCATGAAGACCCTGACCATCCTCGCCATCTCGGCCGTCGCCCAC
GCCGGCGTCTTGGTCCCGCAATGCCCCGAGAAAACTGATGCCGTCAACTGCAGACGAATCTGCTCTTCGGCGGAT
CCGGGGGCGTTCCATTCTGATAAGGTGACGTGTACTCATGTCAAGGATGATGGGAGGGATGCCATTCGCTGCTTG
TCGAATGATCGCTTTGAGTTTGATGTCAAGGTTCCTTGTAAGGGGAAGGAGAAGGCTCCGGAGAAGGCTCCGGGG
GTGGCTGGGCGTACGAAAAAGATTGAGGATCCGGCCGCGGTCCCGGCTCAGAGCACATCCACTGGCCCGGCCAAC
AATCCGTCTCAGGTTCCGGATACTACGAAAAAGGACAAGAATACGGCCGCGGACGCTGGCAAGGGCACACCCAAC
AACCCGGTCCAGGTCCCGCCCGGGTGTGTCCCGATTTCCTCGGAACAGGTGCCGTCGAACGCCGATGAAAGCTCC
TCCCGGGGAAAGGAAGCTCAGGAGTCTAAAACCAACAGCAATCTGGCCGGCCGCTGGGCCTGGCCGTCCCTCGTT
CGCCCACCGTGGCCTCGGCTGGAGGCTGCCATGGATCTGCCCATGCTGTCCGCCCGCGATGACTCGCCCAACGAT
GCCAGCAAGCAGCTACTGGACCTGCTCCAGAATCCCTTCCGGGGACAGATCGCGGCCGTCTCCCTCCCCTTGGCC
TTTGGCATCTCGCTCGGCACCCTCATCTTCACCGCCATCTGCTTCTCCTTCATCCGACCCTACCATCAGGCCATC
TACGCCCCCAAGCTCAAGCACGCCGACAAGAAATATGCGCCGCCTCCCCTCGGCAAGAAGCCCTGGGCGTGGATC
ACGCCCGTATTGCAAACGACCGAGGCATCGCTCGTCCCCCAGATCGGCATGGACGCCACCATCTTTTTGCGCTTC
ACCCGCATGTGCCGCAACATGTTTCTCGTCCTCGCCCTCGTCGGCTTTGCCATCCTCGTGCCCGTCAACGTGGCC
AATTCCACCGTCTACGAAGGCCACATCAGCGACTGGACCATGCGAATTACGCCCCGTGACGTCTGGGGCCAGCCG
CAGTGGGCGCAGGTCGTCGTCGCCTGGCTCTTCGACTTGATCATAATCGGCTTCCTGTGGTACAATTACCGGAGT
GTTCTGCGCCTGCGTCGTCGGTACTTTGAGACGGACGAGTATCAGAACAGCCTGCACTCGCGCACCCTCATGCTC
TACGACCTCCCCCGTCAAGCCCGCTCCGACGAGGGCATCGCCCGCATCATCGACAAGGTGGTGCCCAACTCTTCC
TTTGCCCGCACCGTCGTCGCCCGCAACGTCAAGATCCTTCCAGAGCTCATCGACGAGCATGAGCATGCGGTCCGC
AAGCTCGAAAAGATCCTGGCCAAGTACCTGAAAAACCCGGCTCAGCTGCCCGCCTCGAGACCGACGTGCAAGCCG
TCCAAGAAGGATCGGTCGTTGGACACGTACCCGCGCGGCCAGAAGCTCGATGCCATCGACTACTACACGCAGCGC
ATCCGCGACCTCGAGATTGAGATCAAAGAGGTCCGAGCCAGCGTCGACCGGCGCGGAACGATGCCCTACGGCTTC
GCCAGCTACTCGGACATGGCCGAGGCCCACGCCATCGCCCACGCATGTCGCGGCTCCAAGCCCGAGGGCGCGACG
GTGATGCTGGCGCCCAAGCCGTCGGATATCATCTGGCAGAACATGCCGCTATCCAAGGCGACGCGCAGCCGCCGG
CGATGGATTAACAACTTTTGGATCGTCGTCCTCACCTTTCTCTGGGTCGCCCCCAACGCCATGATGGCCATCTTT
CTCGTTAATCTGAGTAACCTCGGCAAGGTCTGGCCTGCCTTCCAGCGCAACTTCGAGCGCAACATCCAATTCTGG
GGCATGGTTCAAGGCATCGCCTCGCCTGCCCTCACCTCGCTCGTCTACCTGGTGCTGCCCATCATCTTCCGCCGC
CTGTCGGTCCAGGCCGGCGACCAGACCAAGACGGGCCGCGAGAGTCACGTCCTGGCCAGGATGTACTCGTTCTTC
GTCTTCAACAACCTCATCGTCTTCTCCTGCTTCAGCACCATCTGGGCTTTTGTCGCCGGCGTCAAGAAGCGGACC
AACAGCGGGACCAACGCCTGGGAAGCCATCGAGAAGGAGAACATGGCCGCCGCCGTCTTCCTCGCCCTTTGCGAG
AATAGCCTGTTCTGGGTCACGTACCTGCTTCAGCGCGAGCTGGGCATCGCCGTCGATCTGGCCCAGCTGTGGCCC
TTGATCCAGGGCTTTTTCCTCAAGAAGCTGTCGAGCCCGACGCCGCGCGAGCTGATTGAGCTGACGGCGCCGCCT
GCCTTTGACTACGCCAGCTACTACAACTACTTTCTCTTCTACGTGACGGTGACGCTGTGCTTCGCCAGCATCCAG
CCCCTGGTGCTACCGGCCACGGCCCTGTTCTTCTGCTTCGAGGTCTACCTCAAGAAGTACCTGATCCTCTACCGC
TTCGTCACCAAGACGGAGTCCGGGGGCCTGTTTTGGCGCGTCCTCTTCAACCGCTTCATCCTGGCCACGATCCTT
GCGAACCTGGTGGTGCTGCTGACGTGCTGGGTCCGCGGCGACGGCACCCATATTCAGTTCTACGCGGTCGCGCCT
CTCCCGCTCGTCATGATGGCCTTTAAGCTGTACTGCCGCCGCGCCTTTGACGACAAGATCCGCTACTACAGCACC
CGCCTGAGTTCCAAGCTGCACGACGCCCAGCTGCACAAGGAGCCGCGGCTCCGCAGCGAGAAGCTGTCGACGAAG
TTCGGCCACCCGGCGCTGTACAGGCCGCTCATCACGCCCATGGTGCATTCCAAGGCCCAGAACCTGCTGCCCTCG
GTCTACAGGGGACGCCTGACGGACGGGAGGGGCGCCGGGGGGGCATCGGCGGGAGGCGACGACCTGGTCAGCGTC
AGCGGCTACTCGGACATGTACGCCCTCGACGCCATGCAGCAGGGCGGGAAGCCGGGGCAGAGGGACAAGGGACGG
CTGCCGGGCTTCGAGTACGTGTCCGAGTCGCACATGGACTTTGCCTACTACAAGGACCGGGCCGAGTTTACCGAA
CAGCACGGGGGCAGCGAGCTGTACGGGAGGCCGGGGACGCCGGGGACCGACGCCGAGACGCAGTCGCTATCGGGC
CGGTCCTTTTCGGCGACGACGGTGACGCGAACCCGCAGTCCGCTGTACGGGGAGAACTCGGGGAGTCCGCTGTAC
CGGCAGGAGACCGGTGGAGGGAGCCCGCTGTACCCGCGGCAGGATCACGGAGGGAGCCCACTGTACCGGCAGGAT
CACGGAGGCAGCCCGCTGTACTCACACGACAACGGCAGCTCGGCGGGTCTGGTGCGCAACGCGGCGGCCGCTCCG
ACGGGACCGCCTCCCCTGGGGTCCTTTGGCTACAGCGGGCTGGCGCAGGCGGAGGAGTCGGACCCGGGGCGGACG
AGCTATTTCCGGGGGGGGAGTCGGCCGTTGAGGCCGGCGGGGGAGGGGTGGTGA
Gene >Ophun1|2884
ATGGTCGAAGCCATTGATAGAGGTAAGGAGGGGGGGGACTTTTTTTTTTGTGCGGCTGGCGCGCGCGGATGTGGG
CTGATGAAGTTGTTATGTTATAGCGGAGGGGGAGGGCGCGGCGCTGAAGACGGGAGAGATTCCGGGGACGGAGGG
TCTTAACGGTGCGGCTTCGGGGCCGGAGCCGGGGCCGGGGCGTGCGGTTGAGGAGGGGGGGCCGCCGGGGGTGGA
TGTCCGTGGCGGCGCGGCAAAGGTAGCTGCCGTGCTTGAGTCTGCGGCAGCGTCCAACGGCGATGACGCAGCGAG
TCCCAAGGCAGCGAGTCCTCGGGCAATCACCACGCCCCCAACCGCACCGCCGGCCGCCGAACCGGCGTCGAACCA
GGAAGCCAAGCCGACCGCTCCCGAATCATCATCGGATCCCGAGGCAGCGCCAGCCCCAACGGGAGAAAAGCGCAA
GCCGAGTCCCGAGCCAGCAGACGGTAACGGCCCGGAGCTGAAAAGGGCCAAGACGGGCGATGGGGAGGACGGACC
CGTTGCGGCCCACAATGGCGGTGCGCGCAAGGTCGGTCGTCCGCGGAAGAATAGCAAGCGGGAGGTGGGTGCCGT
GACGGCGGCGGCGGGGGGGGGGAGGACGGCGCGGAAGACGAGGAGTCAGGGGCCTGCTGAGCAGTGAAGCGGGTG
GTTGTGTTTGGGGGGATGCTGGTTTGTGGTTGTTCTGATGGGGGAGGGGGGAAAGGCTGATTCGCGGTGCATTGC
GGTGGTGTGGGCATGAGTTGGTTGGCGTGGTTGGCTTGGACTCTTGTCTGCCTTGCCGGCGGTTGCGAAGTGATT
CTGGCTACATGGGTAGGTAGGTAGGTAAGGTAGCCCGGATGGTTGATGGGTTATCCATGACTTGGTTGGAGGACT
AGCGTAGTCATCGCCGTCGATCACGAGTCGGATCGCATAACGAGGCAGACAGCAGCGAATCGAGGACATGACCCA
TCACAAACACAAGTTTAAGAAGCTGCTCTTCCTGCCTTCCCAACCCATCTCCCCATTCAAACACCATCCATCCAA
CCTGTTCACCACACTCGCCACCATGAAGACCCTGACCATCCTCGCCATCTCGGCCGTCGCCCACGCCGGCGTCTT
GGTCCCGCAATGCCCCGAGAAAACTGATGCCGTCAACTGCAGACGAATCTGCTCTTCGGCGGATCCGGGGGCGTT
CCATTCTGATAAGGTGACGTGTACTCATGTCAAGGATGATGGGAGGGATGCCATTCGCTGCTTGTCGAATGATCG
CTTTGAGTTTGATGTGAGTTGAGTTCCTTCCAGTTCTGATGGGATGGGGGGATGGGGGCTGATGGAGGTTGGGTT
GTGTAGGTCAAGGTTCCTTGTAAGGGGAAGGAGAAGGCTCCGGAGAAGGCTCCGGGGGTGGCTGGGCGTACGAAA
AAGATTGAGGATCCGGCCGCGGTCCCGGCTCAGAGCACATCCACTGGCCCGGCCAACAATCCGTCTCAGGTTCCG
GATACTACGAAAAAGGACAAGAATACGGCCGCGGACGCTGGCAAGGGCACACCCAACAACCCGGTCCAGGTCCCG
CCCGGGTGTGTCCCGATTTCCTCGGAACAGGTGCCGTCGAACGCCGATGAAAGCTCCTCCCGGGGAAAGGAAGCT
CAGGAGTCTAAAACCAACAGCAAGTTAGTTGGGAAGCTGCGGTAGCTTGCAGATGTGATGTCTAGATAGTTGTTG
GGTAGTTTCTTGCGAAAAAGGTTCCTGTTTCTAGAAGCTCTTTATCCCGTCGACGTCAGCGGCGCCCACCGCATC
TTTGTCGTTTGCAGTCGTCGGACATATTGCTTTGTCGCGCCGTCACAGAAGATGCGCGACAAACGAGGCACGTTT
CGGGTTGCTGGCGTCGCACTCGGACGGTTGGCTGAGAGCGTTGGCTGGCGAGCAGCGGGGTAGCACAGGGACCAG
GGTTGCTGATGCCGAGCCGTGGGACAATGAGCGTGATCGAGGCTGTTCGTACGAATGTGCTACACGTAGATACAT
GTACTCGTAGAGAAGAGGAGCGCGTTGGAGGTTGCGGTGATGGCATCTTGTTTGTTTTCTCGGATAAGATAGAGT
TAGGCTCGTCTCGCTGAGGACCGTCCTAGCATCCGACCTTTTTCCAAAAATAGAAATTGCCGTTAATCAGGGCCT
TCTCCACTCTGGCGGTTGGTGGAATGCGCCGGCACGAGGCGGTACAGGTACAAGCCGGGTACATGGGCTCTTACG
CCAGAGGGTTGCTGGTGGTGGTGGCAGGTGTCGACTCAGTTGAGGGTATACTTGGGGTCGGAGAGGAACAGATTC
CCTGGACGGCTGTCTACGAGCATGATAAAACTCTTCTGCTATGTACGAACATACATACATCACTCTGTCCTCTCG
AGCCATCCATTCTTCGCCCATTCCCGAATAACCGTCCACATCCCGAAGAGGCTGGCACCTCGGCGGCCCGCATTC
CTCCCTATGGCCGAGCAGGTTCCCCGCAGGTACAGCCCCTGAGACGATCTGTAGAGTGCGCGCATGGATGTACTT
TCATTGTATCATCCCGCCCTGCCCATGCCTGTAATGGTACGTTTACTATACCCAACCCACCGCGCCGCGGCAAAA
CATTCATTCGTCCCAATTAATGCCATCCTCCGCCTTGAATGCAGATCGTGATCCCCCCTCTTCGATTTCTTCAAT
TCTTTCTCTGCGTCTCTGCATTGGCTTTGTTGCTGTTCGGTCGCTCCCGGTTCGCTCCCTGCGAGAAGGACATCT
CACCAATCTGGATCTCTCGTCAATCCTCTACCTTCTTTGTTCCCTCTCCTGACGATCCTCTCTCCTCTCAGCACG
ACTTCCTACCTACTCCTACTCCCCTCGTCCGAACGCGACACTCGCTCCCAAGTCGATCCTCGAGTCCACAGTCTG
GCCGGCCGCTGGGCCTGGCCGTCCCTCGTTCGCCCACCGTGGCCTCGGCTGGAGGCTGCCATGGATCTGCCCATG
CTGTCCGCCCGCGATGACTCGCCCAACGATGCCAGCAAGCAGCTACTGGACCTGCTCCAGAATCCCTTCCGGGGA
CAGGTGAGCTCCTAGTACCTGTCATTGCGCTTCCTACTTTGATCTAACTCGTCGCATCAGATCGCGGCCGTCTCC
CTCCCCTTGGCCTTTGGCATCTCGCTCGGCACCCTCATCTTCACCGCCATCTGCTTCTCCTTCATCCGACCCTAC
CATCAGGCCATCTACGCCCCCAAGCTCAAGCACGCCGACAAGAAATATGCGCCGCCTCCCCTCGGCAAGAAGCCC
TGGGCGTGGATCACGCCCGTATTGCAAACGACCGAGGCATCGCTCGTCCCCCAGATCGGCATGGACGCCACCATC
TTTTTGCGCTTCACCCGCATGTGCCGCAACATGTTTCTCGTCCTCGCCCTCGTCGGCTTTGCCATCCTCGTGCCC
GTCAACGTGGCCAATTCCACCGTCTACGAAGGCCACATCAGCGACTGGACCATGCGAATTACGCCCCGTGACGTC
TGGGGCCAGCCGCAGTGGGCGCAGGTCGTCGTCGCCTGGCTCTTCGACTTGATCATAATCGGCTTCCTGTGGTAC
AATTACCGGAGTGTTCTGCGCCTGCGTCGTCGGTACTTTGAGACGGACGAGTATCAGAACAGCCTGCACTCGCGC
ACCCTCATGGTAGGCCACTATACCCCTTTCCACTGGCCAGCCAGAAAGCTTCCCTTCCTCTCTCTCTCAAACCCT
GGCTATGTACTGACGGCTGCAACAGCTCTACGACCTCCCCCGTCAAGCCCGCTCCGACGAGGGCATCGCCCGCAT
CATCGACAAGGTGGTGCCCAACTCTTCCTTTGCCCGCACCGTCGTCGCCCGCAACGTCAAGATCCTTCCAGAGCT
CATCGACGAGCATGAGCATGCGGTCCGCAAGCTCGAAAAGATCCTGGCCAAGTACCTGAAAAACCCGGCTCAGCT
GCCCGCCTCGAGACCGACGTGCAAGCCGTCCAAGAAGGATCGGTCGTTGGACACGTACCCGCGCGGCCAGAAGCT
CGATGCCATCGACTACTACACGCAGCGCATCCGCGACCTCGAGATTGAGATCAAAGAGGTCCGAGCCAGCGTCGA
CCGGCGCGGAACGATGCCCTACGGCTTCGCCAGCTACTCGGACATGGCCGAGGCCCACGCCATCGCCCACGCATG
TCGCGGCTCCAAGCCCGAGGGCGCGACGGTGATGCTGGCGCCCAAGCCGTCGGATATCATCTGGCAGAACATGCC
GCTATCCAAGGCGACGCGCAGCCGCCGGCGATGGATTAACAACTTTTGGATCGTCGTCCTCACCTTTCTCTGGGT
CGCCCCCAACGCCATGATGGCCATCTTTCTCGTTAATCTGAGTAACCTCGGCAAGGTCTGGCCTGCCTTCCAGCG
CAACTTCGAGCGCAACATCCAATTCTGGGGCATGGTTCAAGGCATCGCCTCGCCTGCCCTCACCTCGCTCGTCTA
CCTGGTGCTGCCCATCATCTTCCGCCGCCTGTCGGTCCAGGCCGGCGACCAGACCAAGACGGGCCGCGAGAGTCA
CGTCCTGGCCAGGATGTACTCGTTCTTCGTCTTCAACAACCTCATCGTCTTCTCCTGCTTCAGCACCATCTGGGC
TTTTGTCGCCGGCGTCAAGAAGCGGACCAACAGCGGGACCAACGCCTGGGAAGCCATCGAGAAGGAGAACATGGC
CGCCGCCGTCTTCCTCGCCCTTTGCGAGAATAGCCTGTTCTGGGTCACGTACCTGCTTCAGCGCGAGCTGGGCAT
CGCCGTCGATCTGGCCCAGCTGTGGCCCTTGATCCAGGGCTTTTTCCTCAAGAAGCTGTCGAGCCCGACGCCGCG
CGAGCTGATTGAGCTGACGGCGCCGCCTGCCTTTGACTACGCCAGCTACTACAACTACTTTCTCTTCTACGTGAC
GGTGACGCTGTGCTTCGCCAGCATCCAGCCCCTGGTGCTACCGGCCACGGCCCTGTTCTTCTGCTTCGAGGTCTA
CCTCAAGAAGTACCTGATCCTCTACCGCTTCGTCACCAAGACGGAGTCCGGGGGCCTGTTTTGGCGCGTCCTCTT
CAACCGCTTCATCCTGGCCACGATCCTTGCGAACCTGGTGGTGCTGCTGACGTGCTGGGTCCGCGGCGACGGCAC
CCATATTCAGTTCTACGCGGTCGCGCCTCTCCCGCTCGTCATGATGGCCTTTAAGCTGTACTGCCGCCGCGCCTT
TGACGACAAGATCCGCTACTACAGCACCCGCCTGAGTTCCAAGCTGCACGACGCCCAGCTGCACAAGGAGCCGCG
GCTCCGCAGCGAGAAGCTGTCGACGAAGTTCGGCCACCCGGCGCTGTACAGGCCGCTCATCACGCCCATGGTGCA
TTCCAAGGCCCAGAACCTGCTGCCCTCGGTCTACAGGGGACGCCTGACGGACGGGAGGGGCGCCGGGGGGGCATC
GGCGGGAGGCGACGACCTGGTCAGCGTCAGCGGCTACTCGGACATGTACGCCCTCGACGCCATGCAGCAGGGCGG
GAAGCCGGGGCAGAGGGACAAGGGACGGCTGCCGGGCTTCGAGTACGTGTCCGAGTCGCACATGGACTTTGCCTA
CTACAAGGACCGGGCCGAGTTTACCGAACAGCACGGGGGCAGCGAGCTGTACGGGAGGCCGGGGACGCCGGGGAC
CGACGCCGAGACGCAGTCGCTATCGGGCCGGTCCTTTTCGGCGACGACGGTGACGCGAACCCGCAGTCCGCTGTA
CGGGGAGAACTCGGGGAGTCCGCTGTACCGGCAGGAGACCGGTGGAGGGAGCCCGCTGTACCCGCGGCAGGATCA
CGGAGGGAGCCCACTGTACCGGCAGGATCACGGAGGCAGCCCGCTGTACTCACACGACAACGGCAGCTCGGCGGG
TCTGGTGCGCAACGCGGCGGCCGCTCCGACGGGACCGCCTCCCCTGGGGTCCTTTGGCTACAGCGGGCTGGCGCA
GGCGGAGGAGTCGGACCCGGGGCGGACGAGCTATTTCCGGGGGGGGAGTCGGCCGTTGAGGCCGGCGGGGGAGGG
GTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail