Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2883
Gene name
LocationContig_257:15466..16674
Strand+
Gene length (bp)1208
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 4.2E-12 77 165
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 2.8E-06 222 325

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AZY1|A1751_ARTBC Probable 1-alkyl-2-acetylglycerophosphocholine esterase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01751 PE=1 SV=1 1 322 7.0E-41

GO

GO Term Description Terminal node
GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity Yes
GO:0016042 lipid catabolic process Yes
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:1901575 organic substance catabolic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0006629 lipid metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 26 0.992158

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4863
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|04603
Ophiocordyceps camponoti-rufipedis Ophun1|2883 (this protein)
Ophiocordyceps kimflemingae Ophio5|1697
Ophiocordyceps subramaniannii Hirsu2|11018
Ophiocordyceps subramaniannii Hirsu2|4499

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2883
MLSPLLLVAALVAVVRAILMPGPIGAFPVAMRTHELTDGSRNDPYAPHNGTHLRRILVSVFLPLDPVQYGDAEIQ
QLPYMPPLTAAEYSRLAQIISPFFEAVFEKLAIEYRRLETIDRGREHATKKKSYPVVLFSPGLGGSRLMYSAGAR
DLASQGYVVITIDHPYDASIVEFPDGSFVRGVNFSTTAQIAAATKVRVQDVLFLVNQLYDSEVLGRLTEGFPGLV
NVKKMAMYGHSLGGATAAEALRRDSRLLGGMNWDGEMQGEAASQGLVQPFVQVGTPDHRHQNNSNWPAFYKKLRG
PKLELEVKNTTHISFTDLPLLLSTMEVPDEAQPSLKHFLGTVSGRRLRRTLTGILKASLEFVFERNGEDVGRLAE
DYCGLTVV*
Coding >Ophun1|2883
ATGCTCTCGCCTCTCCTTCTCGTCGCTGCCCTCGTGGCCGTCGTCCGGGCCATCTTGATGCCTGGGCCGATTGGG
GCGTTTCCGGTGGCGATGCGAACACACGAGCTCACCGATGGCAGCCGGAACGATCCTTATGCGCCTCACAATGGC
ACTCACCTGAGAAGGATCCTCGTCTCCGTCTTTCTGCCGCTCGACCCGGTTCAGTACGGGGATGCCGAGATCCAG
CAGCTGCCTTATATGCCCCCTCTTACGGCGGCCGAGTACAGCAGACTTGCCCAGATCATCTCCCCCTTTTTCGAA
GCCGTGTTTGAGAAGCTGGCGATTGAATATCGACGGCTGGAGACGATTGATCGGGGTCGAGAGCACGCGACGAAA
AAGAAGAGCTACCCGGTCGTCCTCTTTTCGCCCGGACTGGGCGGGTCGAGGTTGATGTACTCTGCCGGCGCCAGG
GATCTGGCCAGTCAAGGCTACGTCGTCATCACCATAGATCATCCTTACGACGCGTCCATTGTCGAGTTTCCCGAT
GGCTCCTTCGTGCGCGGCGTCAACTTTTCGACGACGGCTCAAATTGCGGCCGCCACCAAGGTCCGCGTGCAAGAC
GTCTTATTCCTTGTGAACCAGCTTTACGACTCTGAAGTCCTAGGGCGGCTCACGGAAGGCTTTCCCGGCCTCGTC
AACGTGAAGAAGATGGCCATGTACGGCCACTCGCTGGGCGGCGCGACGGCAGCCGAAGCCTTGCGCAGGGACAGC
CGGCTCCTCGGCGGCATGAACTGGGACGGAGAGATGCAGGGAGAAGCGGCAAGCCAGGGCCTCGTCCAGCCCTTT
GTCCAGGTCGGCACCCCGGATCATCGCCACCAGAACAACTCCAACTGGCCGGCCTTTTACAAGAAGCTGCGCGGG
CCCAAGCTGGAGCTAGAGGTGAAGAACACGACGCACATTTCGTTTACAGACCTGCCGCTGCTGCTGTCGACGATG
GAGGTTCCGGATGAGGCGCAGCCGTCGTTGAAGCACTTCCTGGGGACTGTCAGCGGACGGCGACTGAGGCGGACG
TTGACGGGGATCTTGAAGGCGTCGTTGGAGTTTGTGTTTGAGAGGAATGGGGAGGACGTGGGGAGGTTGGCCGAG
GATTATTGCGGATTGACGGTTGTTTAG
Transcript >Ophun1|2883
ATGCTCTCGCCTCTCCTTCTCGTCGCTGCCCTCGTGGCCGTCGTCCGGGCCATCTTGATGCCTGGGCCGATTGGG
GCGTTTCCGGTGGCGATGCGAACACACGAGCTCACCGATGGCAGCCGGAACGATCCTTATGCGCCTCACAATGGC
ACTCACCTGAGAAGGATCCTCGTCTCCGTCTTTCTGCCGCTCGACCCGGTTCAGTACGGGGATGCCGAGATCCAG
CAGCTGCCTTATATGCCCCCTCTTACGGCGGCCGAGTACAGCAGACTTGCCCAGATCATCTCCCCCTTTTTCGAA
GCCGTGTTTGAGAAGCTGGCGATTGAATATCGACGGCTGGAGACGATTGATCGGGGTCGAGAGCACGCGACGAAA
AAGAAGAGCTACCCGGTCGTCCTCTTTTCGCCCGGACTGGGCGGGTCGAGGTTGATGTACTCTGCCGGCGCCAGG
GATCTGGCCAGTCAAGGCTACGTCGTCATCACCATAGATCATCCTTACGACGCGTCCATTGTCGAGTTTCCCGAT
GGCTCCTTCGTGCGCGGCGTCAACTTTTCGACGACGGCTCAAATTGCGGCCGCCACCAAGGTCCGCGTGCAAGAC
GTCTTATTCCTTGTGAACCAGCTTTACGACTCTGAAGTCCTAGGGCGGCTCACGGAAGGCTTTCCCGGCCTCGTC
AACGTGAAGAAGATGGCCATGTACGGCCACTCGCTGGGCGGCGCGACGGCAGCCGAAGCCTTGCGCAGGGACAGC
CGGCTCCTCGGCGGCATGAACTGGGACGGAGAGATGCAGGGAGAAGCGGCAAGCCAGGGCCTCGTCCAGCCCTTT
GTCCAGGTCGGCACCCCGGATCATCGCCACCAGAACAACTCCAACTGGCCGGCCTTTTACAAGAAGCTGCGCGGG
CCCAAGCTGGAGCTAGAGGTGAAGAACACGACGCACATTTCGTTTACAGACCTGCCGCTGCTGCTGTCGACGATG
GAGGTTCCGGATGAGGCGCAGCCGTCGTTGAAGCACTTCCTGGGGACTGTCAGCGGACGGCGACTGAGGCGGACG
TTGACGGGGATCTTGAAGGCGTCGTTGGAGTTTGTGTTTGAGAGGAATGGGGAGGACGTGGGGAGGTTGGCCGAG
GATTATTGCGGATTGACGGTTGTTTAG
Gene >Ophun1|2883
ATGCTCTCGCCTCTCCTTCTCGTCGCTGCCCTCGTGGCCGTCGTCCGGGCCATCTTGATGCCTGGGCCGATTGGG
GCGTTTCCGGTGGCGATGCGAACACACGAGCTCACCGATGGCAGCCGGAACGATCCTTATGCGCCTCACAATGGC
ACTCACCTGAGAAGGATCCTCGTCTCCGTCTTTCTGCCGCTCGACCCGGTTCAGTACGGGGATGCCGAGATCCAG
CAGCTGCCTTATATGCCCCCTCTTACGGCGGCCGAGTACAGCAGACTTGCCCAGATCATCTCCCCCTTTTTCGAA
GCCGTGTTTGAGAAGCTGGCGATTGAATATCGACGGCTGGAGACGATTGATCGGGGTCGAGAGCACGCGACGAAA
AAGAAGAGCTACCCGGTCGTCCTCTTTTCGCCCGGACTGGGCGGGTCGAGGTTGATGTACTCTGCCGGCGCCAGG
GATCTGGCCAGTCAAGGCTACGTCGTCATCACCATAGATCATCCTTACGACGCGTCCATTGTCGAGTTTCCCGAT
GGCTCCTTCGTGCGCGGCGTCAACTTTTCGACGACGGCTCAAATTGCGGCCGCCACCAAGGTTGGGCGTGCTCGC
ACGAATGGATTGGTGTTGACGAAGGTGCTGACGGCGTGCAGGTCCGCGTGCAAGACGTCTTATTCCTTGTGAACC
AGCTTTACGACTCTGAAGTCCTAGGGCGGCTCACGGAAGGCTTTCCCGGCCTCGTCAACGTGAAGAAGATGGCCA
TGTACGGCCACTCGCTGGGCGGCGCGACGGCAGCCGAAGCCTTGCGCAGGGACAGCCGGCTCCTCGGCGGCATGA
ACTGGGACGGAGAGATGCAGGGAGAAGCGGCAAGCCAGGGCCTCGTCCAGCCCTTTGTCCAGGTCGGCACCCCGG
ATCATCGCCACCAGAACAACTCCAACTGGCCGGCCTTTTACAAGAAGCTGCGCGGGCCCAAGCTGGAGCTAGAGG
TGAAGAACACGACGCACATTTCGTTTACAGACCTGCCGCTGCTGCTGTCGACGATGGAGGTTCCGGATGAGGCGC
AGCCGTCGTTGAAGCACTTCCTGGGGACTGTCAGCGGACGGCGACTGAGGCGGACGTTGACGGGGATCTTGAAGG
CGTCGTTGGAGTTTGTGTTTGAGAGGAATGGGGAGGACGTGGGGAGGTTGGCCGAGGATTATTGCGGATTGACGG
TTGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail