Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2882
Gene name
LocationContig_257:14093..15212
Strand-
Gene length (bp)1119
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00535 Glycos_transf_2 Glycosyl transferase family 2 1.1E-35 120 289
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 2.4E-13 118 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O70152|DPM1_MOUSE Dolichol-phosphate mannosyltransferase subunit 1 OS=Mus musculus GN=Dpm1 PE=1 SV=1 117 348 2.0E-113
sp|Q9WU83|DPM1_CRIGR Dolichol-phosphate mannosyltransferase subunit 1 OS=Cricetulus griseus GN=DPM1 PE=2 SV=1 117 348 2.0E-113
sp|O14466|DPM1_SCHPO Dolichol-phosphate mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpm1 PE=2 SV=1 118 347 8.0E-112
sp|O60762|DPM1_HUMAN Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens GN=DPM1 PE=1 SV=1 117 348 1.0E-111
sp|A5GFZ5|DPM1_PIG Dolichol-phosphate mannosyltransferase subunit 1 OS=Sus scrofa GN=DPM1 PE=3 SV=1 117 348 4.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O70152|DPM1_MOUSE Dolichol-phosphate mannosyltransferase subunit 1 OS=Mus musculus GN=Dpm1 PE=1 SV=1 117 348 2.0E-113
sp|Q9WU83|DPM1_CRIGR Dolichol-phosphate mannosyltransferase subunit 1 OS=Cricetulus griseus GN=DPM1 PE=2 SV=1 117 348 2.0E-113
sp|O14466|DPM1_SCHPO Dolichol-phosphate mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpm1 PE=2 SV=1 118 347 8.0E-112
sp|O60762|DPM1_HUMAN Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens GN=DPM1 PE=1 SV=1 117 348 1.0E-111
sp|A5GFZ5|DPM1_PIG Dolichol-phosphate mannosyltransferase subunit 1 OS=Sus scrofa GN=DPM1 PE=3 SV=1 117 348 4.0E-111
sp|Q1JQ93|DPM1_BOVIN Dolichol-phosphate mannosyltransferase subunit 1 OS=Bos taurus GN=DPM1 PE=2 SV=1 117 348 1.0E-109
sp|Q9VIU7|DPM1_DROME Probable dolichol-phosphate mannosyltransferase OS=Drosophila melanogaster GN=CG10166 PE=3 SV=1 115 348 5.0E-104
sp|Q54LP3|DPM1_DICDI Dolichol-phosphate mannosyltransferase subunit 1 OS=Dictyostelium discoideum GN=dpm1 PE=3 SV=1 117 351 8.0E-94
sp|A0QZ12|PPM1_MYCS2 Polyprenol monophosphomannose synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ppm1 PE=1 SV=1 121 339 3.0E-44
sp|O53493|PPMNT_MYCTU Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppm1 PE=1 SV=1 113 339 1.0E-38
sp|A0A0H3M5A8|PPMNT_MYCBP Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lnt PE=1 SV=1 113 339 1.0E-38
sp|C5CBV8|MPUS_MICLC Undecaprenyl-phosphate mannosyltransferase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=Mlut_12000 PE=1 SV=1 122 344 2.0E-36
sp|P14020|DPM1_YEAST Dolichol-phosphate mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPM1 PE=1 SV=3 118 349 9.0E-25
sp|P54856|DPM1_USTMA Dolichol-phosphate mannosyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DPM1 PE=3 SV=2 120 348 1.0E-21
sp|B4ETL6|ARNC_PROMH Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Proteus mirabilis (strain HI4320) GN=arnC PE=3 SV=1 110 331 3.0E-20
sp|B2VBJ0|ARNC_ERWT9 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=arnC PE=3 SV=1 113 331 6.0E-20
sp|A1JPP5|ARNC_YERE8 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=arnC PE=3 SV=1 110 331 2.0E-18
sp|B7LM77|ARNC_ESCF3 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=arnC PE=3 SV=1 118 331 5.0E-18
sp|B5XTK8|ARNC_KLEP3 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Klebsiella pneumoniae (strain 342) GN=arnC PE=3 SV=1 118 331 7.0E-18
sp|Q2NRV6|ARNC_SODGM Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Sodalis glossinidius (strain morsitans) GN=arnC PE=3 SV=1 117 331 1.0E-17
sp|A4WAM4|ARNC_ENT38 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Enterobacter sp. (strain 638) GN=arnC PE=3 SV=1 110 331 2.0E-17
sp|B5YX45|ARNC_ECO5E Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=arnC PE=3 SV=1 118 331 4.0E-17
sp|Q8XDZ5|ARNC_ECO57 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O157:H7 GN=arnC PE=3 SV=1 118 331 4.0E-17
sp|A4SQW8|ARNC_AERS4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Aeromonas salmonicida (strain A449) GN=arnC PE=3 SV=1 120 333 4.0E-17
sp|B1JJ29|ARNC_YERPY Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=arnC PE=3 SV=1 110 331 5.0E-17
sp|Q93PD9|ARNC_YERPS Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=arnC PE=2 SV=1 110 331 5.0E-17
sp|A4TIM3|ARNC_YERPP Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia pestis (strain Pestoides F) GN=arnC PE=3 SV=1 110 331 5.0E-17
sp|B2K5L4|ARNC_YERPB Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=arnC PE=3 SV=1 110 331 5.0E-17
sp|Q32DT4|ARNC_SHIDS Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=arnC PE=3 SV=2 118 331 7.0E-17
sp|C6DAW6|ARNC_PECCP Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=arnC PE=3 SV=1 120 331 8.0E-17
sp|D4GUA0|AGLD_HALVD Glycosyltransferase AglD OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglD PE=1 SV=1 105 322 1.0E-16
sp|A6TF99|ARNC_KLEP7 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=arnC PE=3 SV=1 118 331 1.0E-16
sp|Q8Z541|ARNC_SALTI Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella typhi GN=arnC PE=3 SV=1 118 331 1.0E-16
sp|A9N5B3|ARNC_SALPB Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=arnC PE=3 SV=1 118 331 1.0E-16
sp|B4SYX0|ARNC_SALNS Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella newport (strain SL254) GN=arnC PE=3 SV=1 118 331 1.0E-16
sp|C0Q070|ARNC_SALPC Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella paratyphi C (strain RKS4594) GN=arnC PE=3 SV=1 118 331 1.0E-16
sp|Q57M56|ARNC_SALCH Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella choleraesuis (strain SC-B67) GN=arnC PE=3 SV=1 118 331 1.0E-16
sp|O52324|ARNC_SALTY Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=arnC PE=2 SV=1 118 331 2.0E-16
sp|B4TPI1|ARNC_SALSV Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella schwarzengrund (strain CVM19633) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|B4TBG5|ARNC_SALHS Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella heidelberg (strain SL476) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|B5EZH7|ARNC_SALA4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella agona (strain SL483) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|A0KGY7|ARNC_AERHH Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=arnC PE=3 SV=1 120 333 2.0E-16
sp|Q3YZV2|ARNC_SHISS Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Shigella sonnei (strain Ss046) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|Q31YK3|ARNC_SHIBS Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Shigella boydii serotype 4 (strain Sb227) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|B6I7J7|ARNC_ECOSE Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain SE11) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|P77757|ARNC_ECOLI Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain K12) GN=arnC PE=1 SV=1 118 331 2.0E-16
sp|B1IXT3|ARNC_ECOLC Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|A8A2C1|ARNC_ECOHS Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O9:H4 (strain HS) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|B1X8W7|ARNC_ECODH Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain K12 / DH10B) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|C4ZU96|ARNC_ECOBW Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|B7LAR9|ARNC_ECO55 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain 55989 / EAEC) GN=arnC PE=3 SV=1 118 331 2.0E-16
sp|Q1CIH6|ARNC_YERPN Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=arnC PE=3 SV=1 110 331 3.0E-16
sp|A9R094|ARNC_YERPG Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=arnC PE=3 SV=1 110 331 3.0E-16
sp|Q8ZDX7|ARNC_YERPE Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia pestis GN=arnC PE=3 SV=1 110 331 3.0E-16
sp|Q1C741|ARNC_YERPA Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=arnC PE=3 SV=1 110 331 3.0E-16
sp|Q7UC63|ARNC_SHIFL Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Shigella flexneri GN=arnC PE=3 SV=2 118 331 3.0E-16
sp|B1LLK8|ARNC_ECOSM Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=arnC PE=3 SV=1 118 331 4.0E-16
sp|B7M5T6|ARNC_ECO8A Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O8 (strain IAI1) GN=arnC PE=3 SV=1 118 331 4.0E-16
sp|A7ZP72|ARNC_ECO24 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=arnC PE=3 SV=1 118 331 4.0E-16
sp|B7N5L9|ARNC_ECOLU Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=arnC PE=3 SV=1 118 331 5.0E-16
sp|B7UFR6|ARNC_ECO27 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=arnC PE=3 SV=1 118 346 6.0E-16
sp|B5BCP7|ARNC_SALPK Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella paratyphi A (strain AKU_12601) GN=arnC PE=3 SV=1 118 331 6.0E-16
sp|Q5PNA5|ARNC_SALPA Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=arnC PE=3 SV=1 118 331 6.0E-16
sp|Q6D2F0|ARNC_PECAS Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=arnC PE=3 SV=1 120 331 7.0E-16
sp|B5RCC3|ARNC_SALG2 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=arnC PE=3 SV=1 118 331 7.0E-16
sp|B5R271|ARNC_SALEP Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella enteritidis PT4 (strain P125109) GN=arnC PE=3 SV=1 118 331 7.0E-16
sp|B5FNT8|ARNC_SALDC Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella dublin (strain CT_02021853) GN=arnC PE=3 SV=1 118 331 7.0E-16
sp|B7NNT3|ARNC_ECO7I Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=arnC PE=3 SV=1 118 331 8.0E-16
sp|Q0T2M9|ARNC_SHIF8 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Shigella flexneri serotype 5b (strain 8401) GN=arnC PE=3 SV=1 118 331 8.0E-16
sp|Q1R9G1|ARNC_ECOUT Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain UTI89 / UPEC) GN=arnC PE=3 SV=1 118 331 8.0E-16
sp|Q8FFM2|ARNC_ECOL6 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=arnC PE=3 SV=1 118 331 8.0E-16
sp|Q0TFI8|ARNC_ECOL5 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=arnC PE=3 SV=1 118 331 8.0E-16
sp|A1ADA6|ARNC_ECOK1 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O1:K1 / APEC GN=arnC PE=3 SV=1 118 331 8.0E-16
sp|B7MXT5|ARNC_ECO81 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O81 (strain ED1a) GN=arnC PE=3 SV=1 118 331 8.0E-16
sp|B7MG21|ARNC_ECO45 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=arnC PE=3 SV=1 118 331 8.0E-16
sp|Q3KCC2|ARNC_PSEPF Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=arnC PE=3 SV=1 120 331 1.0E-15
sp|C3KAD3|ARNC_PSEFS Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas fluorescens (strain SBW25) GN=arnC PE=3 SV=1 120 338 2.0E-15
sp|A8GDR6|ARNC_SERP5 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Serratia proteamaculans (strain 568) GN=arnC PE=3 SV=1 118 331 2.0E-15
sp|C5BDQ5|ARNC_EDWI9 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Edwardsiella ictaluri (strain 93-146) GN=arnC PE=3 SV=1 110 333 3.0E-15
sp|A2DSR8|ALG5E_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5E OS=Trichomonas vaginalis GN=ALG5E PE=1 SV=1 120 334 6.0E-15
sp|Q58619|Y1222_METJA Uncharacterized protein MJ1222 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1222 PE=4 SV=1 107 350 6.0E-15
sp|Q9HY64|ARNC_PSEAE Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=arnC PE=3 SV=1 117 331 3.0E-14
sp|B7VBN3|ARNC_PSEA8 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas aeruginosa (strain LESB58) GN=arnC PE=3 SV=1 117 331 3.0E-14
sp|Q02R24|ARNC_PSEAB Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=arnC PE=3 SV=1 117 331 3.0E-14
sp|A2DZE8|ALG5A_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5A OS=Trichomonas vaginalis GN=ALG5A PE=1 SV=1 119 337 4.0E-14
sp|P0A598|Y553_MYCBO Uncharacterized glycosyltransferase Mb0553 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0553 PE=3 SV=1 115 334 7.0E-14
sp|P9WMY1|Y539_MYCTU Uncharacterized glycosyltransferase Rv0539 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0539 PE=1 SV=1 115 334 7.0E-14
sp|P9WMY0|Y539_MYCTO Uncharacterized glycosyltransferase MT0564 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0564 PE=3 SV=1 115 334 7.0E-14
sp|Q4ZSZ3|ARNC_PSEU2 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=arnC PE=3 SV=1 120 331 9.0E-14
sp|Q4KC83|ARNC_PSEF5 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=arnC PE=3 SV=1 120 331 1.0E-13
sp|Q48HZ2|ARNC_PSE14 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=arnC PE=3 SV=1 120 331 1.0E-13
sp|A6V1P1|ARNC_PSEA7 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas aeruginosa (strain PA7) GN=arnC PE=3 SV=1 117 331 2.0E-13
sp|A8FRR3|ARNC_SHESH Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Shewanella sediminis (strain HAW-EB3) GN=arnC PE=3 SV=1 110 333 3.0E-13
sp|Q8D342|ARNC_WIGBR Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Wigglesworthia glossinidia brevipalpis GN=arnC PE=3 SV=1 118 351 4.0E-13
sp|A2EK20|ALG5B_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5B OS=Trichomonas vaginalis GN=ALG5B PE=1 SV=1 120 322 6.0E-13
sp|A2ELE6|ALG5C_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5C OS=Trichomonas vaginalis GN=ALG5C PE=1 SV=1 120 341 7.0E-13
sp|Q45539|CSBB_BACSU Putative glycosyltransferase CsbB OS=Bacillus subtilis (strain 168) GN=csbB PE=2 SV=1 120 340 1.0E-12
sp|A2E3C6|ALG5D_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5D OS=Trichomonas vaginalis GN=ALG5D PE=1 SV=1 120 334 1.0E-12
sp|Q54J42|ALG5_DICDI Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum GN=alg5 PE=2 SV=1 119 324 1.0E-12
sp|Q7N3Q6|ARNC_PHOLL Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=arnC PE=2 SV=1 118 331 3.0E-12
sp|O34319|YKCC_BACSU Uncharacterized glycosyltransferase YkcC OS=Bacillus subtilis (strain 168) GN=ykcC PE=3 SV=2 118 289 2.0E-10
sp|Q55487|Y501_SYNY3 Uncharacterized glycosyltransferase sll0501 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0501 PE=3 SV=1 118 289 3.0E-10
sp|P74505|Y1943_SYNY3 Uncharacterized glycosyltransferase slr1943 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1943 PE=3 SV=1 96 240 3.0E-10
sp|D4GZ42|DPM1L_HALVD Dolichyl-phosphate hexose transferase HVO_1613 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_1613 PE=3 SV=1 117 332 5.0E-10
sp|P57022|GTRB_BPP22 Bactoprenol glucosyl transferase OS=Enterobacteria phage P22 GN=gtrB PE=3 SV=1 118 334 1.0E-09
sp|P71054|EPSE_BACSU Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) GN=epsE PE=2 SV=2 115 237 2.0E-09
sp|D4GU74|AGL6_HALVD Low-salt glycan biosynthesis hexosyltransferase Agl6 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl6 PE=3 SV=1 119 332 2.0E-09
sp|Q57964|Y544_METJA Uncharacterized protein MJ0544 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0544 PE=4 SV=1 122 347 5.0E-09
sp|Q9T1D6|GTRB_BPSFX Bactoprenol glucosyl transferase OS=Shigella phage SfX GN=gtrB PE=3 SV=1 118 289 6.0E-09
sp|P77293|GTRB_ECOLI Bactoprenol glucosyl transferase homolog from prophage CPS-53 OS=Escherichia coli (strain K12) GN=yfdH PE=1 SV=1 118 289 7.0E-09
sp|O22007|GTRB_BPSF5 Bactoprenol glucosyl transferase OS=Shigella phage SfV GN=gtrB PE=3 SV=1 118 289 3.0E-08
sp|P68667|GTRB_SHIFL SfII prophage-derived bactoprenol glucosyl transferase OS=Shigella flexneri GN=gtrB PE=3 SV=1 118 289 4.0E-08
sp|P68668|GTRB_BPSF2 Bactoprenol glucosyl transferase OS=Shigella phage SfII GN=gtrB PE=3 SV=1 118 289 4.0E-08
sp|P11290|YIBD_ECOLI Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) GN=yibD PE=3 SV=2 114 233 4.0E-07
sp|D4GYG7|AGLE_HALVD Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglE PE=1 SV=1 120 244 3.0E-06
sp|Q9VLQ1|ALG5_DROME Dolichyl-phosphate beta-glucosyltransferase OS=Drosophila melanogaster GN=wol PE=1 SV=1 85 350 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2882
MLHTALGSRKEAQDDPRSPSEYRIEMKKEHRLESRQLGGLTGGSDAALDLGGDPLSRKKDRGFERAHLGDQVGPQ
LLSHGLLYAIREHPDMATLTTTDSPDAFDTTQDTMAAKKSGDKFSVILPTYNERRNLPIVTWLLNRTFTQHDLDW
ELIIVDDGSPDGTQQVAEQLARVYAPHVVLKPRAGKLGLGTAYVHGLSFATGTFVIIMDADFSHHPKFIPRMIEV
QREGNYDIVTGTRYRPGGGVYGWDLRRKLVSRGANLFADTVLRPGVSDLTGSFRLYRRAVLERVIADTESKGYTF
QMEMMVRAKALGCSVAEVPISFVDRVYGESKLGGDEIVEYAKGVFSLWLKV*
Coding >Ophun1|2882
ATGCTGCATACGGCTCTGGGCAGCCGAAAAGAGGCACAAGACGATCCCCGATCACCATCCGAGTACCGTATCGAG
ATGAAGAAAGAGCATCGCCTCGAGAGTCGACAACTTGGAGGTTTGACGGGCGGGTCAGATGCTGCCCTTGATCTT
GGCGGTGATCCCTTGAGCCGTAAGAAGGATCGAGGGTTTGAAAGGGCGCATCTCGGCGATCAAGTCGGACCGCAG
CTGCTGAGTCATGGCCTCCTTTACGCCATCAGAGAGCATCCGGACATGGCCACTTTGACGACAACAGACTCGCCA
GACGCCTTTGACACGACTCAAGACACAATGGCAGCGAAAAAGAGCGGCGACAAGTTCTCCGTCATCTTGCCAACC
TACAACGAACGACGCAACCTCCCCATCGTCACCTGGCTCCTCAACCGGACCTTTACCCAGCACGACCTCGACTGG
GAGCTCATCATCGTCGACGACGGCTCCCCGGATGGCACGCAGCAGGTCGCCGAGCAGCTCGCGCGCGTCTACGCA
CCGCACGTCGTCCTCAAGCCTCGCGCCGGCAAGCTTGGTCTAGGAACGGCCTACGTCCATGGGCTGAGCTTCGCG
ACGGGCACCTTTGTCATCATCATGGACGCCGACTTTAGCCATCATCCGAAATTTATCCCGCGCATGATCGAGGTC
CAGCGCGAGGGAAACTACGACATCGTGACTGGCACGCGTTACCGGCCTGGAGGCGGGGTCTATGGCTGGGATCTG
CGCAGGAAGCTCGTTAGCCGGGGGGCCAACCTCTTTGCCGATACCGTTTTGCGTCCTGGCGTCAGCGATCTGACC
GGTAGCTTTCGTCTCTATCGCAGGGCTGTGCTGGAGCGCGTCATCGCCGACACGGAGAGCAAGGGGTATACGTTC
CAGATGGAGATGATGGTACGGGCCAAGGCCTTGGGCTGCTCCGTTGCAGAGGTGCCCATCTCGTTTGTCGATCGG
GTCTATGGCGAGAGCAAGCTGGGCGGCGACGAGATTGTCGAGTACGCCAAGGGGGTGTTTTCGCTGTGGCTCAAG
GTCTGA
Transcript >Ophun1|2882
ATGCTGCATACGGCTCTGGGCAGCCGAAAAGAGGCACAAGACGATCCCCGATCACCATCCGAGTACCGTATCGAG
ATGAAGAAAGAGCATCGCCTCGAGAGTCGACAACTTGGAGGTTTGACGGGCGGGTCAGATGCTGCCCTTGATCTT
GGCGGTGATCCCTTGAGCCGTAAGAAGGATCGAGGGTTTGAAAGGGCGCATCTCGGCGATCAAGTCGGACCGCAG
CTGCTGAGTCATGGCCTCCTTTACGCCATCAGAGAGCATCCGGACATGGCCACTTTGACGACAACAGACTCGCCA
GACGCCTTTGACACGACTCAAGACACAATGGCAGCGAAAAAGAGCGGCGACAAGTTCTCCGTCATCTTGCCAACC
TACAACGAACGACGCAACCTCCCCATCGTCACCTGGCTCCTCAACCGGACCTTTACCCAGCACGACCTCGACTGG
GAGCTCATCATCGTCGACGACGGCTCCCCGGATGGCACGCAGCAGGTCGCCGAGCAGCTCGCGCGCGTCTACGCA
CCGCACGTCGTCCTCAAGCCTCGCGCCGGCAAGCTTGGTCTAGGAACGGCCTACGTCCATGGGCTGAGCTTCGCG
ACGGGCACCTTTGTCATCATCATGGACGCCGACTTTAGCCATCATCCGAAATTTATCCCGCGCATGATCGAGGTC
CAGCGCGAGGGAAACTACGACATCGTGACTGGCACGCGTTACCGGCCTGGAGGCGGGGTCTATGGCTGGGATCTG
CGCAGGAAGCTCGTTAGCCGGGGGGCCAACCTCTTTGCCGATACCGTTTTGCGTCCTGGCGTCAGCGATCTGACC
GGTAGCTTTCGTCTCTATCGCAGGGCTGTGCTGGAGCGCGTCATCGCCGACACGGAGAGCAAGGGGTATACGTTC
CAGATGGAGATGATGGTACGGGCCAAGGCCTTGGGCTGCTCCGTTGCAGAGGTGCCCATCTCGTTTGTCGATCGG
GTCTATGGCGAGAGCAAGCTGGGCGGCGACGAGATTGTCGAGTACGCCAAGGGGGTGTTTTCGCTGTGGCTCAAG
GTCTGA
Gene >Ophun1|2882
ATGCTGCATACGGCTCTGGGCAGCCGAAAAGAGGCACAAGACGATCCCCGATCACCATCCGAGTACCGTATCGAG
ATGAAGAAAGAGCATCGCCTCGAGAGTCGACAACTTGGAGGTTTGACGGGCGGGTCAGATGCTGCCCTTGATCTT
GGCGGTGATCCCTTGAGCCGTAAGAAGGATCGAGGGTTTGAAAGGGCGCATCTCGGCGATCAAGTCGGACCGCAG
CTGCTGAGTCATGGCCTCCTTTACGCCATCAGAGAGCATCCGGACATGGCCACTTTGACGACAACAGACTCGCCA
GACGCCTTTGACACGACTCAAGACACAATGGCAGCGAAAAAGAGCGGCGACAAGTTCTCCGTCATCTTGCCAACC
TACAACGAACGACGCAACCTCCCCATCGTCACCTGGCTCCTCAACCGGACCTTTACCCAGCAGTCAGACCCCCCC
TTCCACCCCCTCCCCTCCCAGCTTGGCTGAAGCTGAAAGAAACCCGCCAGCGACCTCGACTGGGAGCTCATCATC
GTCGACGACGGCTCCCCGGATGGCACGCAGCAGGTCGCCGAGCAGCTCGCGCGCGTCTACGCACCGCACGTCGTC
CTCAAGCCTCGCGCCGGCAAGCTTGGTCTAGGAACGGCCTACGTCCATGGGCTGAGCTTCGCGACGGGCACCTTT
GTCATCATCATGGACGCCGACTTTAGCCATCATCCGAAATTTATCCCGCGCATGATCGAGGTCCAGCGCGAGGGA
AACTACGACATCGTGACTGGCACGCGTTACCGGCCTGGAGGCGGGGTCTATGGCTGGGATCTGCGCAGGAAGCTC
GTTAGCCGGGGGGCCAACCTCTTTGCCGATACCGTTTTGCGTCCTGGCGTCAGCGATCTGACCGGTAGCTTTCGT
CTCTATCGCAGGGCTGTGCTGGAGCGCGTCATCGCCGACACGGAGAGCAAGGGGTATACGTTCCAGATGGAGATG
ATGGTACGGGCCAAGGCCTTGGGCTGCTCCGTTGCAGAGGTGCCCATCTCGTTTGTCGATCGGGTCTATGGCGAG
AGCAAGCTGGGCGGCGACGAGATTGTCGAGTACGCCAAGGGGGTGTTTTCGCTGTGGCTCAAGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail