Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|288
Gene name
LocationContig_1072:163..496
Strand+
Gene length (bp)333
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06658 DUF1168 Protein of unknown function (DUF1168) 5.4E-07 1 60

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003725 double-stranded RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003723 RNA binding No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1269
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7511
Ophiocordyceps australis map64 (Brazil) OphauB2|2368
Ophiocordyceps camponoti-floridani Ophcf2|05707
Ophiocordyceps camponoti-rufipedis Ophun1|288 (this protein)
Ophiocordyceps kimflemingae Ophio5|6464
Ophiocordyceps subramaniannii Hirsu2|1053

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|288
MDAELQRQRDQEGFVRDREERDRRDRDKTRRNRDKRDKAKARKAAAAANKNSDPSVATYAEAPSPAPGFDHDINR
PSVSAPTRNRPDDRDRDDEPATAEPATGLVIHDDD*
Coding >Ophun1|288
ATGGATGCCGAGTTGCAGCGGCAGAGGGATCAGGAGGGGTTTGTGCGCGATCGGGAGGAGAGGGATCGGAGGGAT
CGTGATAAGACGAGGAGGAATCGCGATAAGAGGGACAAGGCAAAGGCTAGGAAGGCCGCCGCCGCCGCCAACAAA
AACTCGGATCCGTCCGTCGCTACCTACGCTGAGGCCCCGTCTCCGGCACCGGGATTCGACCACGATATCAACCGT
CCTTCAGTCTCCGCACCGACCCGGAACCGCCCCGACGACCGAGACAGAGACGACGAACCGGCTACGGCTGAACCA
GCTACTGGCCTCGTCATTCACGACGACGATTGA
Transcript >Ophun1|288
ATGGATGCCGAGTTGCAGCGGCAGAGGGATCAGGAGGGGTTTGTGCGCGATCGGGAGGAGAGGGATCGGAGGGAT
CGTGATAAGACGAGGAGGAATCGCGATAAGAGGGACAAGGCAAAGGCTAGGAAGGCCGCCGCCGCCGCCAACAAA
AACTCGGATCCGTCCGTCGCTACCTACGCTGAGGCCCCGTCTCCGGCACCGGGATTCGACCACGATATCAACCGT
CCTTCAGTCTCCGCACCGACCCGGAACCGCCCCGACGACCGAGACAGAGACGACGAACCGGCTACGGCTGAACCA
GCTACTGGCCTCGTCATTCACGACGACGATTGA
Gene >Ophun1|288
ATGGATGCCGAGTTGCAGCGGCAGAGGGATCAGGAGGGGTTTGTGCGCGATCGGGAGGAGAGGGATCGGAGGGAT
CGTGATAAGACGAGGAGGAATCGCGATAAGAGGGACAAGGCAAAGGCTAGGAAGGCCGCCGCCGCCGCCAACAAA
AACTCGGATCCGTCCGTCGCTACCTACGCTGAGGCCCCGTCTCCGGCACCGGGATTCGACCACGATATCAACCGT
CCTTCAGTCTCCGCACCGACCCGGAACCGCCCCGACGACCGAGACAGAGACGACGAACCGGCTACGGCTGAACCA
GCTACTGGCCTCGTCATTCACGACGACGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail