Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2879
Gene name
LocationContig_257:5292..7759
Strand-
Gene length (bp)2467
Transcript length (bp)2343
Coding sequence length (bp)2343
Protein length (aa) 781

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05089 NAGLU Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain 2.1E-123 134 474
PF12972 NAGLU_C Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain 1.7E-55 482 750
PF12971 NAGLU_N Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain 2.5E-07 28 119

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P54802|ANAG_HUMAN Alpha-N-acetylglucosaminidase OS=Homo sapiens GN=NAGLU PE=1 SV=2 38 728 3.0E-116

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2879
MLLLTALHHLLLLLLFLPVLATATPTAGIAALADRILGPGRGAELHLVLTAERELWSRCKPAVNDGYVVEAGRDG
RVRVEASTLSAMARGLRHYATENLHLDDFWVVGPGRHLPAGPLPAPARTLRGTSVVPWRYNLNTVTFSYSFAWYD
WPDWERLLDWCAWRGINVQLAWVGYESIYLDSFRALGLTDAEILPFFSGPAFQAWNRFGNVHGSWGDRGDLPLSW
IRGQAQLQRRIVARMVELGITPVLPAFPGFVPDALLRVRPGADVVRAGSWLGPGYENLSTLFLKPSDGTYAELQR
EFIRRQTEAYGNVSNVYTLDQFNEMVPPVGSDDEASLGRISRDTYASLTAANPAAVWMMQGWLFTAHAAFWTPGR
IEAYLGAVEGENSLVVLDLFAESEPLWIRTRSFASRPWVWCMLHNFGGNMNLYGRASAVVSGPARARSSSPSLVG
IGLSPEAYANNEVIYDLVLDQAWTTTANISAWFARWATLRYAGAGKVVPRSLLRAWQLLRTHVYDYGGDDIPSAG
VGIWQLFPSLEGLVGRKGHAPAPTALHYEPGRLRPVWRLMVEAARERPALWHLPAFRLDFVDVSRQLLSNAFIDA
YVALVAAFRAAVPPRPHSPGLSRSRSAAVTERSADLLRILDGLDLVLSSEPEYRLSTWLSASRRWADEMNSTEAL
LAFNARSQITVWMKGVPALDDYSARAWAGLTCCYYRRRWAVFVDGLKDAAAGGEWDEAAVNRSIRTVEDEWQHRG
FDADSRVVFPVPSVRSLVGLLEMSWPRVFG*
Coding >Ophun1|2879
ATGCTTCTCCTCACAGCCCTCCATCACCTCCTCCTCCTCCTCCTCTTCCTCCCCGTCCTCGCCACCGCCACGCCA
ACAGCCGGCATCGCCGCCCTCGCAGACCGCATCCTCGGCCCCGGACGTGGCGCCGAGCTACATCTCGTGCTGACG
GCCGAGCGCGAGCTCTGGTCACGGTGCAAACCGGCTGTCAATGATGGATATGTTGTTGAGGCGGGGAGGGATGGG
AGGGTGCGTGTTGAGGCGTCGACGTTGAGTGCTATGGCGAGGGGGCTGAGACACTACGCTACTGAGAATCTTCAT
CTCGACGACTTCTGGGTCGTCGGTCCGGGACGTCATCTCCCTGCCGGTCCGCTTCCGGCTCCGGCCCGGACACTC
CGAGGCACAAGCGTCGTGCCCTGGCGATACAACCTCAACACCGTCACCTTCTCCTACTCGTTCGCCTGGTACGAC
TGGCCCGACTGGGAGAGGCTCCTCGACTGGTGCGCCTGGCGCGGCATCAACGTCCAGCTCGCATGGGTGGGCTAC
GAGAGCATCTACCTCGACAGCTTCCGTGCCCTAGGCCTCACCGACGCCGAGATCCTCCCCTTCTTCAGCGGCCCA
GCCTTCCAAGCCTGGAACCGATTCGGCAACGTGCACGGCTCCTGGGGCGACCGCGGAGACCTCCCCCTCTCCTGG
ATACGGGGACAGGCACAGCTGCAGCGGCGGATCGTCGCTCGGATGGTCGAGCTGGGCATCACGCCCGTTCTGCCG
GCCTTTCCGGGCTTCGTGCCGGATGCGTTGCTGAGGGTGAGGCCTGGTGCTGATGTTGTTCGCGCGGGGAGTTGG
CTTGGACCGGGGTATGAGAATCTGAGTACGCTGTTTTTGAAGCCGAGTGATGGCACTTACGCTGAGCTGCAGCGG
GAGTTTATTCGGCGACAGACGGAGGCTTATGGGAACGTCTCCAACGTCTATACTCTTGATCAGTTCAACGAGATG
GTGCCTCCCGTTGGATCCGATGACGAGGCTTCGCTGGGGAGGATATCGCGCGATACGTACGCTTCACTCACGGCT
GCGAACCCTGCGGCTGTGTGGATGATGCAGGGTTGGCTGTTTACTGCTCATGCTGCCTTCTGGACGCCGGGGAGG
ATAGAGGCCTACCTTGGAGCTGTGGAAGGGGAGAATTCACTCGTGGTGCTGGATTTGTTTGCCGAGAGTGAACCG
CTTTGGATCAGGACGCGGTCGTTTGCGTCGAGGCCGTGGGTCTGGTGCATGCTTCACAACTTTGGCGGGAATATG
AATCTCTACGGCCGGGCTTCAGCCGTCGTCTCCGGTCCGGCTCGGGCGAGAAGCTCGTCTCCTTCGCTGGTGGGC
ATTGGTCTTTCTCCTGAAGCATACGCCAACAATGAAGTCATATACGACCTCGTTCTCGATCAAGCCTGGACGACA
ACGGCCAACATCTCAGCCTGGTTCGCTCGCTGGGCTACTCTTCGCTATGCCGGCGCCGGAAAGGTTGTGCCCCGT
TCGCTGCTCCGAGCGTGGCAGCTTCTTCGAACGCACGTGTACGACTATGGCGGTGATGATATCCCCAGCGCGGGT
GTGGGAATCTGGCAACTCTTTCCGAGTCTCGAGGGCCTCGTCGGACGCAAGGGTCATGCTCCGGCACCGACGGCA
CTGCACTATGAGCCGGGTAGGCTGCGACCTGTGTGGCGGTTGATGGTCGAAGCTGCAAGGGAGAGGCCGGCGCTA
TGGCATCTCCCTGCGTTCCGGCTGGATTTCGTAGATGTTTCCCGGCAGTTGCTTTCAAATGCCTTTATCGATGCC
TACGTCGCTCTGGTCGCTGCCTTCCGTGCCGCCGTGCCGCCTCGGCCCCACTCACCCGGTTTGAGCCGGAGTCGT
TCGGCGGCCGTGACGGAGCGGAGCGCCGACCTGCTACGGATCCTGGACGGGCTGGACCTCGTGCTCTCTTCTGAG
CCGGAGTATCGACTTTCCACTTGGCTGTCGGCATCGCGACGGTGGGCAGACGAGATGAACTCAACGGAAGCGCTA
CTGGCTTTCAACGCCCGAAGTCAGATTACCGTCTGGATGAAAGGCGTGCCGGCGCTGGATGATTACTCTGCGCGC
GCTTGGGCGGGACTGACGTGTTGTTATTACCGGAGACGGTGGGCGGTCTTCGTCGATGGCTTGAAAGATGCTGCT
GCGGGAGGTGAATGGGATGAAGCTGCGGTAAATAGGTCGATACGGACGGTAGAGGATGAGTGGCAGCATCGTGGC
TTTGACGCTGATTCCCGGGTTGTCTTTCCCGTGCCGTCTGTCAGGAGTTTGGTTGGACTGCTGGAGATGAGTTGG
CCTCGCGTATTTGGGTGA
Transcript >Ophun1|2879
ATGCTTCTCCTCACAGCCCTCCATCACCTCCTCCTCCTCCTCCTCTTCCTCCCCGTCCTCGCCACCGCCACGCCA
ACAGCCGGCATCGCCGCCCTCGCAGACCGCATCCTCGGCCCCGGACGTGGCGCCGAGCTACATCTCGTGCTGACG
GCCGAGCGCGAGCTCTGGTCACGGTGCAAACCGGCTGTCAATGATGGATATGTTGTTGAGGCGGGGAGGGATGGG
AGGGTGCGTGTTGAGGCGTCGACGTTGAGTGCTATGGCGAGGGGGCTGAGACACTACGCTACTGAGAATCTTCAT
CTCGACGACTTCTGGGTCGTCGGTCCGGGACGTCATCTCCCTGCCGGTCCGCTTCCGGCTCCGGCCCGGACACTC
CGAGGCACAAGCGTCGTGCCCTGGCGATACAACCTCAACACCGTCACCTTCTCCTACTCGTTCGCCTGGTACGAC
TGGCCCGACTGGGAGAGGCTCCTCGACTGGTGCGCCTGGCGCGGCATCAACGTCCAGCTCGCATGGGTGGGCTAC
GAGAGCATCTACCTCGACAGCTTCCGTGCCCTAGGCCTCACCGACGCCGAGATCCTCCCCTTCTTCAGCGGCCCA
GCCTTCCAAGCCTGGAACCGATTCGGCAACGTGCACGGCTCCTGGGGCGACCGCGGAGACCTCCCCCTCTCCTGG
ATACGGGGACAGGCACAGCTGCAGCGGCGGATCGTCGCTCGGATGGTCGAGCTGGGCATCACGCCCGTTCTGCCG
GCCTTTCCGGGCTTCGTGCCGGATGCGTTGCTGAGGGTGAGGCCTGGTGCTGATGTTGTTCGCGCGGGGAGTTGG
CTTGGACCGGGGTATGAGAATCTGAGTACGCTGTTTTTGAAGCCGAGTGATGGCACTTACGCTGAGCTGCAGCGG
GAGTTTATTCGGCGACAGACGGAGGCTTATGGGAACGTCTCCAACGTCTATACTCTTGATCAGTTCAACGAGATG
GTGCCTCCCGTTGGATCCGATGACGAGGCTTCGCTGGGGAGGATATCGCGCGATACGTACGCTTCACTCACGGCT
GCGAACCCTGCGGCTGTGTGGATGATGCAGGGTTGGCTGTTTACTGCTCATGCTGCCTTCTGGACGCCGGGGAGG
ATAGAGGCCTACCTTGGAGCTGTGGAAGGGGAGAATTCACTCGTGGTGCTGGATTTGTTTGCCGAGAGTGAACCG
CTTTGGATCAGGACGCGGTCGTTTGCGTCGAGGCCGTGGGTCTGGTGCATGCTTCACAACTTTGGCGGGAATATG
AATCTCTACGGCCGGGCTTCAGCCGTCGTCTCCGGTCCGGCTCGGGCGAGAAGCTCGTCTCCTTCGCTGGTGGGC
ATTGGTCTTTCTCCTGAAGCATACGCCAACAATGAAGTCATATACGACCTCGTTCTCGATCAAGCCTGGACGACA
ACGGCCAACATCTCAGCCTGGTTCGCTCGCTGGGCTACTCTTCGCTATGCCGGCGCCGGAAAGGTTGTGCCCCGT
TCGCTGCTCCGAGCGTGGCAGCTTCTTCGAACGCACGTGTACGACTATGGCGGTGATGATATCCCCAGCGCGGGT
GTGGGAATCTGGCAACTCTTTCCGAGTCTCGAGGGCCTCGTCGGACGCAAGGGTCATGCTCCGGCACCGACGGCA
CTGCACTATGAGCCGGGTAGGCTGCGACCTGTGTGGCGGTTGATGGTCGAAGCTGCAAGGGAGAGGCCGGCGCTA
TGGCATCTCCCTGCGTTCCGGCTGGATTTCGTAGATGTTTCCCGGCAGTTGCTTTCAAATGCCTTTATCGATGCC
TACGTCGCTCTGGTCGCTGCCTTCCGTGCCGCCGTGCCGCCTCGGCCCCACTCACCCGGTTTGAGCCGGAGTCGT
TCGGCGGCCGTGACGGAGCGGAGCGCCGACCTGCTACGGATCCTGGACGGGCTGGACCTCGTGCTCTCTTCTGAG
CCGGAGTATCGACTTTCCACTTGGCTGTCGGCATCGCGACGGTGGGCAGACGAGATGAACTCAACGGAAGCGCTA
CTGGCTTTCAACGCCCGAAGTCAGATTACCGTCTGGATGAAAGGCGTGCCGGCGCTGGATGATTACTCTGCGCGC
GCTTGGGCGGGACTGACGTGTTGTTATTACCGGAGACGGTGGGCGGTCTTCGTCGATGGCTTGAAAGATGCTGCT
GCGGGAGGTGAATGGGATGAAGCTGCGGTAAATAGGTCGATACGGACGGTAGAGGATGAGTGGCAGCATCGTGGC
TTTGACGCTGATTCCCGGGTTGTCTTTCCCGTGCCGTCTGTCAGGAGTTTGGTTGGACTGCTGGAGATGAGTTGG
CCTCGCGTATTTGGGTGA
Gene >Ophun1|2879
ATGCTTCTCCTCACAGCCCTCCATCACCTCCTCCTCCTCCTCCTCTTCCTCCCCGTCCTCGCCACCGCCACGCCA
ACAGCCGGCATCGCCGCCCTCGCAGACCGCATCCTCGGCCCCGGACGTGGCGCCGAGCTACATCTCGTGCTGACG
GCCGAGCGCGAGCTCTGGTCACGGTGCAAACCGGCTGTCAATGATGGATATGTTGTTGAGGCGGGGAGGGATGGG
AGGGTGCGTGTTGAGGCGTCGACGTTGAGTGCTATGGCGAGGGGGTTCGTCTTTTTCCTTTTTTTTTCTCTCTGG
GAATGCTTCTTAACGTCAAGGGTGATTAGGCTGAGACACTACGCTACTGAGAATCTTCATCTCGACGACTTCTGG
GTCGTCGGTCCGGGACGTCATCTCCCTGCCGGTCCGCTTCCGGCTCCGGCCCGGACACTCCGAGGCACAAGCGTC
GTGCCCTGGCGATACAACCTCAACACCGGTAACGGCCATCCCTCTAATATCTGTGTGAATGAAAGAATCCTGACT
CAACAAACGACTCACAGTCACCTTCTCCTACTCGTTCGCCTGGTACGACTGGCCCGACTGGGAGAGGCTCCTCGA
CTGGTGCGCCTGGCGCGGCATCAACGTCCAGCTCGCATGGGTGGGCTACGAGAGCATCTACCTCGACAGCTTCCG
TGCCCTAGGCCTCACCGACGCCGAGATCCTCCCCTTCTTCAGCGGCCCAGCCTTCCAAGCCTGGAACCGATTCGG
CAACGTGCACGGCTCCTGGGGCGACCGCGGAGACCTCCCCCTCTCCTGGATACGGGGACAGGCACAGCTGCAGCG
GCGGATCGTCGCTCGGATGGTCGAGCTGGGCATCACGCCCGTTCTGCCGGCCTTTCCGGGCTTCGTGCCGGATGC
GTTGCTGAGGGTGAGGCCTGGTGCTGATGTTGTTCGCGCGGGGAGTTGGCTTGGACCGGGGTATGAGAATCTGAG
TACGCTGTTTTTGAAGCCGAGTGATGGCACTTACGCTGAGCTGCAGCGGGAGTTTATTCGGCGACAGACGGAGGC
TTATGGGAACGTCTCCAACGTCTATACTCTTGATCAGTTCAACGAGATGGTGCCTCCCGTTGGATCCGATGACGA
GGCTTCGCTGGGGAGGATATCGCGCGATACGTACGCTTCACTCACGGCTGCGAACCCTGCGGCTGTGTGGATGAT
GCAGGGTTGGCTGTTTACTGCTCATGCTGCCTTCTGGACGCCGGGGAGGATAGAGGCCTACCTTGGAGCTGTGGA
AGGGGAGAATTCACTCGTGGTGCTGGATTTGTTTGCCGAGAGTGAACCGCTTTGGATCAGGACGCGGTCGTTTGC
GTCGAGGCCGTGGGTCTGGTGCATGCTTCACAACTTTGGCGGGAATATGAATCTCTACGGCCGGGCTTCAGCCGT
CGTCTCCGGTCCGGCTCGGGCGAGAAGCTCGTCTCCTTCGCTGGTGGGCATTGGTCTTTCTCCTGAAGCATACGC
CAACAATGAAGTCATATACGACCTCGTTCTCGATCAAGCCTGGACGACAACGGCCAACATCTCAGCCTGGTTCGC
TCGCTGGGCTACTCTTCGCTATGCCGGCGCCGGAAAGGTTGTGCCCCGTTCGCTGCTCCGAGCGTGGCAGCTTCT
TCGAACGCACGTGTACGACTATGGCGGTGATGATATCCCCAGCGCGGGTGTGGGAATCTGGCAACTCTTTCCGAG
TCTCGAGGGCCTCGTCGGACGCAAGGGTCATGCTCCGGCACCGACGGCACTGCACTATGAGCCGGGTAGGCTGCG
ACCTGTGTGGCGGTTGATGGTCGAAGCTGCAAGGGAGAGGCCGGCGCTATGGCATCTCCCTGCGTTCCGGCTGGA
TTTCGTAGATGTTTCCCGGCAGTTGCTTTCAAATGCCTTTATCGATGCCTACGTCGCTCTGGTCGCTGCCTTCCG
TGCCGCCGTGCCGCCTCGGCCCCACTCACCCGGTTTGAGCCGGAGTCGTTCGGCGGCCGTGACGGAGCGGAGCGC
CGACCTGCTACGGATCCTGGACGGGCTGGACCTCGTGCTCTCTTCTGAGCCGGAGTATCGACTTTCCACTTGGCT
GTCGGCATCGCGACGGTGGGCAGACGAGATGAACTCAACGGAAGCGCTACTGGCTTTCAACGCCCGAAGTCAGAT
TACCGTCTGGATGAAAGGCGTGCCGGCGCTGGATGATTACTCTGCGCGCGCTTGGGCGGGACTGACGTGTTGTTA
TTACCGGAGACGGTGGGCGGTCTTCGTCGATGGCTTGAAAGATGCTGCTGCGGGAGGTGAATGGGATGAAGCTGC
GGTAAATAGGTCGATACGGACGGTAGAGGATGAGTGGCAGCATCGTGGCTTTGACGCTGATTCCCGGGTTGTCTT
TCCCGTGCCGTCTGTCAGGAGTTTGGTTGGACTGCTGGAGATGAGTTGGCCTCGCGTATTTGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail