Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2876
Gene name
LocationContig_256:16267..20862
Strand-
Gene length (bp)4595
Transcript length (bp)2871
Coding sequence length (bp)2871
Protein length (aa) 957

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04109 ATG9 Autophagy protein ATG9 2.7E-196 44 533
PF00153 Mito_carr Mitochondrial carrier protein 1.1E-09 693 757
PF00153 Mito_carr Mitochondrial carrier protein 4.6E-18 766 852
PF00153 Mito_carr Mitochondrial carrier protein 1.1E-21 857 952

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q875A7|ATG9_PODAS Autophagy-related protein 9 OS=Podospora anserina GN=ATG9 PE=3 SV=1 1 661 0.0E+00
sp|Q7S4D7|ATG9_NEUCR Autophagy-related protein 9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-7 PE=3 SV=1 26 758 0.0E+00
sp|Q51WZ9|ATG9_MAGO7 Autophagy-related protein 9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG9 PE=3 SV=1 2 618 0.0E+00
sp|A7ERK1|ATG9_SCLS1 Autophagy-related protein 9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg9 PE=3 SV=2 2 626 0.0E+00
sp|Q2UUT6|ATG9_ASPOR Autophagy-related protein 9 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg9 PE=3 SV=1 3 635 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q875A7|ATG9_PODAS Autophagy-related protein 9 OS=Podospora anserina GN=ATG9 PE=3 SV=1 1 661 0.0E+00
sp|Q7S4D7|ATG9_NEUCR Autophagy-related protein 9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-7 PE=3 SV=1 26 758 0.0E+00
sp|Q51WZ9|ATG9_MAGO7 Autophagy-related protein 9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG9 PE=3 SV=1 2 618 0.0E+00
sp|A7ERK1|ATG9_SCLS1 Autophagy-related protein 9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg9 PE=3 SV=2 2 626 0.0E+00
sp|Q2UUT6|ATG9_ASPOR Autophagy-related protein 9 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg9 PE=3 SV=1 3 635 0.0E+00
sp|A2QLJ9|ATG9_ASPNC Autophagy-related protein 9 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg9 PE=3 SV=1 1 606 0.0E+00
sp|A1CU77|ATG9_ASPCL Autophagy-related protein 9 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg9 PE=3 SV=1 3 617 0.0E+00
sp|Q4WLT9|ATG9_ASPFU Autophagy-related protein 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg9 PE=3 SV=1 9 605 0.0E+00
sp|A7KAM0|ATG9_PENRW Autophagy-related protein 9 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg9 PE=3 SV=1 32 606 0.0E+00
sp|A1DNW0|ATG9_NEOFI Autophagy-related protein 9 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg9 PE=3 SV=1 3 605 0.0E+00
sp|Q1E6Q3|ATG9_COCIM Autophagy-related protein 9 OS=Coccidioides immitis (strain RS) GN=ATG9 PE=3 SV=1 32 624 0.0E+00
sp|Q5B6U6|ATG9_EMENI Autophagy-related protein 9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg9 PE=3 SV=1 84 605 9.0E-176
sp|Q0UYL2|ATG9_PHANO Autophagy-related protein 9 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG9 PE=3 SV=1 32 601 1.0E-175
sp|Q75A48|ATG9_ASHGO Autophagy-related protein 9 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG9 PE=3 SV=1 25 573 1.0E-164
sp|Q6FQT7|ATG9_CANGA Autophagy-related protein 9 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG9 PE=3 SV=1 37 593 1.0E-157
sp|Q12142|ATG9_YEAST Autophagy-related protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG9 PE=1 SV=1 37 573 9.0E-157
sp|A6ZXH8|ATG9_YEAS7 Autophagy-related protein 9 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG9 PE=3 SV=1 37 573 1.0E-156
sp|Q6C2F5|ATG9_YARLI Autophagy-related protein 9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG9 PE=3 SV=1 39 614 4.0E-156
sp|Q4P683|ATG9_USTMA Autophagy-related protein 9 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG9 PE=3 SV=1 26 573 5.0E-154
sp|A7TR50|ATG9_VANPO Autophagy-related protein 9 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG9 PE=3 SV=1 37 604 9.0E-154
sp|Q6CT08|ATG9_KLULA Autophagy-related protein 9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG9 PE=3 SV=1 31 573 5.0E-150
sp|O74312|ATG9_SCHPO Autophagy-related protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg9 PE=1 SV=1 37 532 5.0E-142
sp|P0CM40|ATG9_CRYNJ Autophagy-related protein 9 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG9 PE=3 SV=1 32 547 2.0E-139
sp|P0CM41|ATG9_CRYNB Autophagy-related protein 9 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG9 PE=3 SV=1 32 547 2.0E-139
sp|A7KAI7|ATG9_PICAN Autophagy-related protein 9 OS=Pichia angusta GN=ATG9 PE=3 SV=1 40 573 4.0E-137
sp|Q6TGJ4|ATG9_CRYGA Autophagy-related protein 9 OS=Cryptococcus gattii GN=ATG9 PE=3 SV=1 82 539 2.0E-135
sp|Q876N4|ATG9_PICPA Autophagy-related protein 9 OS=Komagataella pastoris GN=ATG9 PE=3 SV=1 4 547 1.0E-129
sp|A5DEX5|ATG9_PICGU Autophagy-related protein 9 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG9 PE=3 SV=2 32 657 8.0E-118
sp|Q6BW58|ATG9_DEBHA Autophagy-related protein 9 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG9 PE=3 SV=2 39 536 8.0E-113
sp|Q5ANC9|ATG9_CANAL Autophagy-related protein 9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG9 PE=3 SV=1 39 536 2.0E-110
sp|A3LZS3|ATG9_PICST Autophagy-related protein 9 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG9 PE=3 SV=3 39 536 6.0E-110
sp|Q54NA3|ATG9_DICDI Autophagy-related protein 9 OS=Dictyostelium discoideum GN=atg9 PE=2 SV=1 51 569 4.0E-92
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 672 951 8.0E-84
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 672 950 5.0E-77
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 672 952 2.0E-75
sp|Q8RUS5|ATG9_ARATH Autophagy-related protein 9 OS=Arabidopsis thaliana GN=ATG9 PE=2 SV=1 50 573 6.0E-74
sp|Q3T904|ATG9A_BOVIN Autophagy-related protein 9A OS=Bos taurus GN=ATG9A PE=2 SV=1 40 587 3.0E-69
sp|Q5FWU3|ATG9A_RAT Autophagy-related protein 9A OS=Rattus norvegicus GN=Atg9a PE=1 SV=1 27 587 5.0E-69
sp|Q5RCS0|ATG9A_PONAB Autophagy-related protein 9A OS=Pongo abelii GN=ATG9A PE=2 SV=1 40 587 2.0E-68
sp|Q7Z3C6|ATG9A_HUMAN Autophagy-related protein 9A OS=Homo sapiens GN=ATG9A PE=1 SV=3 40 587 2.0E-68
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 672 955 6.0E-62
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 672 952 3.0E-61
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 668 952 4.0E-61
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 672 952 2.0E-60
sp|Q7T292|MFRN2_DANRE Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 672 954 4.0E-60
sp|Q96A46|MFRN2_HUMAN Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 669 954 2.0E-58
sp|Q8R0Z5|MFRN2_MOUSE Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 669 954 2.0E-58
sp|Q620A6|MFRN_CAEBR Mitoferrin OS=Caenorhabditis briggsae GN=CBG02884 PE=3 SV=1 690 946 7.0E-57
sp|Q23125|MFRN_CAEEL Mitoferrin OS=Caenorhabditis elegans GN=W02B12.9 PE=3 SV=1 672 946 1.0E-56
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 672 949 7.0E-51
sp|Q68FE2|ATG9A_MOUSE Autophagy-related protein 9A OS=Mus musculus GN=Atg9a PE=1 SV=1 27 462 2.0E-46
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 662 946 3.0E-45
sp|Q6EBV9|ATG9B_MOUSE Autophagy-related protein 9B OS=Mus musculus GN=Atg9b PE=2 SV=2 46 538 1.0E-39
sp|Q674R7|ATG9B_HUMAN Autophagy-related protein 9B OS=Homo sapiens GN=ATG9B PE=2 SV=1 46 538 2.0E-39
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 706 954 6.0E-27
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 699 944 2.0E-25
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 708 953 2.0E-25
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 706 954 3.0E-25
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 706 954 3.0E-25
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 706 953 3.0E-25
sp|Q10442|YDE9_SCHPO Uncharacterized mitochondrial carrier C12B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.09 PE=3 SV=1 680 943 9.0E-25
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 681 953 3.0E-24
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 676 949 5.0E-24
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 676 949 7.0E-24
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 677 948 9.0E-24
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 681 946 9.0E-24
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 704 953 1.0E-23
sp|Q8TBP6|S2540_HUMAN Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 708 953 2.0E-23
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 668 949 2.0E-23
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 708 954 3.0E-23
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 677 943 6.0E-23
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 677 954 6.0E-23
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 708 953 6.0E-23
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 682 944 6.0E-23
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 676 943 8.0E-23
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 708 954 1.0E-22
sp|Q9BSK2|S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 699 944 1.0E-22
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 708 953 1.0E-22
sp|Q3TZX3|S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 699 944 1.0E-22
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 680 952 1.0E-22
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 676 949 2.0E-22
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 705 944 2.0E-22
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 694 946 2.0E-22
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 708 953 4.0E-22
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 676 949 5.0E-22
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 681 950 8.0E-22
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 678 944 8.0E-22
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 678 944 2.0E-21
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 678 944 2.0E-21
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 680 954 5.0E-21
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 697 949 5.0E-21
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 693 943 1.0E-20
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 654 951 2.0E-20
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 680 946 2.0E-20
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 715 943 3.0E-20
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 727 945 4.0E-20
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 717 953 5.0E-20
sp|Q76PC3|YQ73_SCHPO Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 705 953 6.0E-20
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 687 937 8.0E-20
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 683 943 9.0E-20
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 678 949 9.0E-20
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 708 943 2.0E-19
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 723 943 2.0E-19
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 693 949 2.0E-19
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 682 949 2.0E-19
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 664 945 3.0E-19
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 663 949 3.0E-19
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 693 949 3.0E-19
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 684 943 3.0E-19
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 682 946 3.0E-19
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 723 943 3.0E-19
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 683 946 4.0E-19
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 683 946 4.0E-19
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 670 951 5.0E-19
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 683 947 5.0E-19
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 723 943 5.0E-19
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 681 946 6.0E-19
sp|P34519|TXTP_CAEEL Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 693 953 6.0E-19
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 723 946 7.0E-19
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 681 943 1.0E-18
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 685 948 2.0E-18
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 685 954 2.0E-18
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 693 949 2.0E-18
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 717 946 2.0E-18
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 687 952 2.0E-18
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 680 946 3.0E-18
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 662 951 3.0E-18
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 693 943 3.0E-18
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 687 943 4.0E-18
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 680 944 5.0E-18
sp|Q499U1|S2538_RAT Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 693 943 5.0E-18
sp|Q5U3V7|S2543_DANRE Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 683 953 1.0E-17
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 673 946 1.0E-17
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 681 946 1.0E-17
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 683 946 2.0E-17
sp|O94344|YHMB_SCHPO Uncharacterized mitochondrial carrier C1271.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.11 PE=3 SV=1 712 949 2.0E-17
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 708 953 2.0E-17
sp|Q91XD8|S2538_MOUSE Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 693 943 2.0E-17
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 710 949 3.0E-17
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 673 943 3.0E-17
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 693 943 3.0E-17
sp|Q8R0Y8|S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus GN=Slc25a42 PE=1 SV=1 631 924 4.0E-17
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 693 949 4.0E-17
sp|Q5U680|SAMC_MOUSE S-adenosylmethionine mitochondrial carrier protein OS=Mus musculus GN=Slc25a26 PE=1 SV=2 677 951 4.0E-17
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 710 944 5.0E-17
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 700 946 6.0E-17
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 708 943 6.0E-17
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 683 943 7.0E-17
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 710 944 7.0E-17
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 693 949 8.0E-17
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 678 955 8.0E-17
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 683 946 9.0E-17
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 693 943 1.0E-16
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 683 946 1.0E-16
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 693 949 1.0E-16
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 693 949 1.0E-16
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 682 943 2.0E-16
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 683 943 2.0E-16
sp|P53320|MTM1_YEAST Mitochondrial carrier protein MTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTM1 PE=1 SV=1 698 949 2.0E-16
sp|P0C546|S2542_RAT Mitochondrial coenzyme A transporter SLC25A42 OS=Rattus norvegicus GN=Slc25a42 PE=2 SV=1 680 924 2.0E-16
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 702 947 2.0E-16
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 687 951 2.0E-16
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 693 949 2.0E-16
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 710 944 2.0E-16
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 683 943 2.0E-16
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 710 943 3.0E-16
sp|Q6DJ08|S2538_XENTR Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 693 943 3.0E-16
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 723 943 3.0E-16
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 677 951 3.0E-16
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 683 946 4.0E-16
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 677 951 4.0E-16
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 693 943 4.0E-16
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 673 955 5.0E-16
sp|Q5EAC0|S2538_BOVIN Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 693 943 5.0E-16
sp|Q9VBN7|SAMC_DROME S-adenosylmethionine mitochondrial carrier protein homolog OS=Drosophila melanogaster GN=CG4743 PE=2 SV=2 685 945 6.0E-16
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 693 943 7.0E-16
sp|Q1ECW7|S247A_DANRE Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 708 945 8.0E-16
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 682 954 8.0E-16
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 722 953 1.0E-15
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 673 943 1.0E-15
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 708 949 1.0E-15
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 690 954 1.0E-15
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 708 945 2.0E-15
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 680 949 2.0E-15
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 622 944 2.0E-15
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 673 943 2.0E-15
sp|Q6GLA2|SAMC_XENTR S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis GN=slc25a26 PE=2 SV=1 684 948 2.0E-15
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 683 943 2.0E-15
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 708 948 2.0E-15
sp|Q9LJX5|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 687 953 3.0E-15
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 708 943 3.0E-15
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 708 945 6.0E-15
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 772 953 7.0E-15
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 693 943 7.0E-15
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 711 950 9.0E-15
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 683 943 1.0E-14
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 681 953 1.0E-14
sp|Q6ZT89|S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 682 945 1.0E-14
sp|O95847|UCP4_HUMAN Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 682 943 1.0E-14
sp|Q641C8|SAMC_XENLA S-adenosylmethionine mitochondrial carrier protein OS=Xenopus laevis GN=slc25a26 PE=2 SV=1 681 956 2.0E-14
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 687 942 2.0E-14
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 683 943 2.0E-14
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 708 943 2.0E-14
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 708 945 2.0E-14
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 708 948 3.0E-14
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 693 943 3.0E-14
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 704 936 3.0E-14
sp|Q9P7X9|YH66_SCHPO Uncharacterized mitochondrial carrier P23A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.06 PE=3 SV=1 710 955 3.0E-14
sp|Q86I81|MCFI_DICDI Mitochondrial substrate carrier family protein I OS=Dictyostelium discoideum GN=mcfI PE=2 SV=1 718 944 4.0E-14
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 681 946 5.0E-14
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 693 948 5.0E-14
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 659 953 6.0E-14
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 681 943 6.0E-14
sp|A1CIF6|S2538_ASPCL Solute carrier family 25 member 38 homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_051330 PE=3 SV=1 726 943 7.0E-14
sp|A1CWA4|S2538_NEOFI Solute carrier family 25 member 38 homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_103940 PE=3 SV=1 726 943 7.0E-14
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 772 953 1.0E-13
sp|Q4WQC5|S2538_ASPFU Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12340 PE=3 SV=1 726 943 1.0E-13
sp|B0Y4J4|S2538_ASPFC Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_069300 PE=3 SV=1 726 943 1.0E-13
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 682 944 1.0E-13
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 683 945 1.0E-13
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 717 943 1.0E-13
sp|Q3MHI3|S2548_BOVIN Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 704 945 1.0E-13
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 772 943 2.0E-13
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 708 949 2.0E-13
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 693 943 2.0E-13
sp|P38127|RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 710 944 2.0E-13
sp|Q8BGF9|S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus GN=Slc25a44 PE=1 SV=1 690 943 2.0E-13
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 693 943 2.0E-13
sp|Q8WUT9|S2543_HUMAN Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 691 953 2.0E-13
sp|Q3ZBJ8|MFRN1_BOVIN Mitoferrin-1 OS=Bos taurus GN=SLC25A37 PE=2 SV=1 672 765 3.0E-13
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 678 949 3.0E-13
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 771 951 4.0E-13
sp|Q5RD67|S2544_PONAB Solute carrier family 25 member 44 OS=Pongo abelii GN=SLC25A44 PE=2 SV=2 690 943 4.0E-13
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 772 943 6.0E-13
sp|Q96H78|S2544_HUMAN Solute carrier family 25 member 44 OS=Homo sapiens GN=SLC25A44 PE=2 SV=1 690 943 6.0E-13
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 678 949 7.0E-13
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 678 949 8.0E-13
sp|Q9M038|SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 693 943 8.0E-13
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 682 945 1.0E-12
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 717 852 2.0E-12
sp|Q84UC7|BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 678 953 2.0E-12
sp|Q12289|CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 693 951 2.0E-12
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 678 952 2.0E-12
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 704 946 2.0E-12
sp|Q09834|YAD8_SCHPO Uncharacterized mitochondrial carrier C4G8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.08 PE=3 SV=1 728 947 2.0E-12
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 767 947 3.0E-12
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 682 943 3.0E-12
sp|Q6C6I3|S2538_YARLI Solute carrier family 25 member 38 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E09284g PE=3 SV=1 725 943 3.0E-12
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 678 949 3.0E-12
sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 680 949 3.0E-12
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 753 949 4.0E-12
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 678 949 4.0E-12
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 690 944 4.0E-12
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 662 943 4.0E-12
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 730 948 5.0E-12
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 772 952 6.0E-12
sp|A6RAY2|S2538_AJECN Solute carrier family 25 member 38 homolog OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06120 PE=3 SV=1 677 943 6.0E-12
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 677 841 7.0E-12
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 677 841 7.0E-12
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 693 943 7.0E-12
sp|Q0CT66|S2538_ASPTN Solute carrier family 25 member 38 homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03118 PE=3 SV=1 726 943 8.0E-12
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 690 944 9.0E-12
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 781 953 1.0E-11
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 772 956 1.0E-11
sp|P12234|MPCP_BOVIN Phosphate carrier protein, mitochondrial OS=Bos taurus GN=SLC25A3 PE=1 SV=1 722 949 1.0E-11
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 693 944 1.0E-11
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 708 952 1.0E-11
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 657 944 1.0E-11
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 771 952 2.0E-11
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 772 955 2.0E-11
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 772 943 2.0E-11
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 772 943 2.0E-11
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 677 841 2.0E-11
sp|Q9SJY5|PUMP5_ARATH Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana GN=PUMP5 PE=2 SV=1 708 858 2.0E-11
sp|Q6GLJ0|MFN2A_XENLA Mitoferrin-2A OS=Xenopus laevis GN=slc25a28-a PE=2 SV=1 672 760 2.0E-11
sp|Q68F18|MFN2B_XENLA Mitoferrin-2B OS=Xenopus laevis GN=slc25a28-b PE=2 SV=1 672 759 2.0E-11
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 659 951 2.0E-11
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 772 956 3.0E-11
sp|A2Q9F0|S2538_ASPNC Solute carrier family 25 member 38 homolog OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g07650 PE=3 SV=1 726 943 3.0E-11
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 708 943 3.0E-11
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 677 841 4.0E-11
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 703 858 4.0E-11
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 766 948 4.0E-11
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 756 928 4.0E-11
sp|Q1DRJ3|S2538_COCIM Solute carrier family 25 member 38 homolog OS=Coccidioides immitis (strain RS) GN=CIMG_07070 PE=3 SV=1 686 943 5.0E-11
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 710 891 5.0E-11
sp|Q8VEM8|MPCP_MOUSE Phosphate carrier protein, mitochondrial OS=Mus musculus GN=Slc25a3 PE=1 SV=1 693 949 5.0E-11
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 766 954 6.0E-11
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 772 943 6.0E-11
sp|O13660|YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 717 943 6.0E-11
sp|Q5B717|S2538_EMENI Solute carrier family 25 member 38 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3663 PE=3 SV=2 726 943 6.0E-11
sp|Q05962|ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 703 932 6.0E-11
sp|B2VSU4|S2538_PYRTR Solute carrier family 25 member 38 homolog OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_00728 PE=3 SV=1 693 956 6.0E-11
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 728 943 7.0E-11
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 693 949 7.0E-11
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 766 956 8.0E-11
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 772 950 8.0E-11
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 657 847 8.0E-11
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 696 943 8.0E-11
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 693 852 9.0E-11
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 772 956 9.0E-11
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 703 858 9.0E-11
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 687 863 1.0E-10
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 771 952 1.0E-10
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 767 950 1.0E-10
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 772 953 1.0E-10
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 772 943 1.0E-10
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 682 939 1.0E-10
sp|P40614|MPCP_CAEEL Phosphate carrier protein, mitochondrial OS=Caenorhabditis elegans GN=F01G4.6 PE=2 SV=1 693 946 1.0E-10
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 722 943 1.0E-10
sp|O97649|UCP3_PIG Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 772 928 1.0E-10
sp|A7TDX5|TPC1_VANPO Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 681 943 1.0E-10
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 756 953 1.0E-10
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 767 956 2.0E-10
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 770 949 2.0E-10
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 760 951 2.0E-10
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 772 951 2.0E-10
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 703 858 2.0E-10
sp|Q6DHS9|S2548_DANRE Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 693 949 2.0E-10
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 700 926 2.0E-10
sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 703 932 2.0E-10
sp|Q0UUH1|TPC1_PHANO Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 683 943 2.0E-10
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 772 955 3.0E-10
sp|Q76PC3|YQ73_SCHPO Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 764 943 3.0E-10
sp|Q5RD67|S2544_PONAB Solute carrier family 25 member 44 OS=Pongo abelii GN=SLC25A44 PE=2 SV=2 773 944 3.0E-10
sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 708 932 3.0E-10
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 772 953 3.0E-10
sp|Q00325|MPCP_HUMAN Phosphate carrier protein, mitochondrial OS=Homo sapiens GN=SLC25A3 PE=1 SV=2 693 949 3.0E-10
sp|Q54W11|MCFL_DICDI Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 680 949 3.0E-10
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 685 952 3.0E-10
sp|Q5R7W2|MPCP_PONAB Phosphate carrier protein, mitochondrial OS=Pongo abelii GN=SLC25A3 PE=2 SV=1 693 949 3.0E-10
sp|Q9LV81|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 707 852 3.0E-10
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 671 822 4.0E-10
sp|P38087|YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 681 944 4.0E-10
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 653 949 4.0E-10
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 771 952 5.0E-10
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 771 953 5.0E-10
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 759 954 5.0E-10
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 771 952 6.0E-10
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 772 950 6.0E-10
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 765 952 6.0E-10
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 771 953 6.0E-10
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 772 956 6.0E-10
sp|O77792|UCP3_BOVIN Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 756 928 6.0E-10
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 772 953 6.0E-10
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 773 950 6.0E-10
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 703 949 6.0E-10
sp|O04200|PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana GN=PXN PE=1 SV=1 710 943 6.0E-10
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 767 954 7.0E-10
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 772 951 7.0E-10
sp|Q09834|YAD8_SCHPO Uncharacterized mitochondrial carrier C4G8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.08 PE=3 SV=1 765 954 7.0E-10
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 772 928 7.0E-10
sp|A7TIQ0|S2538_VANPO Solute carrier family 25 member 38 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1043p32 PE=3 SV=1 718 943 7.0E-10
sp|P16036|MPCP_RAT Phosphate carrier protein, mitochondrial OS=Rattus norvegicus GN=Slc25a3 PE=1 SV=1 693 949 7.0E-10
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 695 943 7.0E-10
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 772 953 7.0E-10
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 772 950 8.0E-10
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 703 858 8.0E-10
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 771 924 8.0E-10
sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 703 932 8.0E-10
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 695 942 8.0E-10
sp|O70579|PM34_MOUSE Peroxisomal membrane protein PMP34 OS=Mus musculus GN=Slc25a17 PE=1 SV=1 717 943 8.0E-10
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 708 952 9.0E-10
sp|Q5R5A1|ADT2_PONAB ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 708 932 9.0E-10
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 771 952 1.0E-09
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 771 953 1.0E-09
sp|Q96H78|S2544_HUMAN Solute carrier family 25 member 44 OS=Homo sapiens GN=SLC25A44 PE=2 SV=1 773 944 1.0E-09
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 773 926 1.0E-09
sp|Q8SQH5|ADT2_BOVIN ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 708 932 1.0E-09
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 703 949 1.0E-09
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 695 942 1.0E-09
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 696 945 1.0E-09
sp|P32331|YMC1_YEAST Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 678 945 1.0E-09
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 703 923 1.0E-09
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 771 952 2.0E-09
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 773 953 2.0E-09
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 773 953 2.0E-09
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 860 954 2.0E-09
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 854 949 2.0E-09
sp|Q8BGF9|S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus GN=Slc25a44 PE=1 SV=1 773 944 2.0E-09
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 763 954 2.0E-09
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 772 953 2.0E-09
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 772 928 2.0E-09
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 772 953 2.0E-09
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 693 949 2.0E-09
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 684 856 2.0E-09
sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 708 932 2.0E-09
sp|Q09073|ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 708 932 2.0E-09
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 771 953 3.0E-09
sp|P23641|MPCP_YEAST Mitochondrial phosphate carrier protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIR1 PE=1 SV=1 693 942 3.0E-09
sp|P10861|UCP1_BOVIN Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 771 953 3.0E-09
sp|Q7DNC3|MPCP1_ARATH Mitochondrial phosphate carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MPT1 PE=2 SV=1 727 947 3.0E-09
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 771 952 4.0E-09
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 771 952 4.0E-09
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 708 943 4.0E-09
sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 703 932 5.0E-09
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 786 953 6.0E-09
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 773 950 6.0E-09
sp|P40035|PIC2_YEAST Mitochondrial phosphate carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIC2 PE=1 SV=1 693 948 6.0E-09
sp|B0DK57|S2538_LACBS Solute carrier family 25 member 38 homolog OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_191230 PE=3 SV=1 683 943 6.0E-09
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 756 928 7.0E-09
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 773 953 7.0E-09
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 708 932 7.0E-09
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 671 823 8.0E-09
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 771 951 8.0E-09
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 771 924 9.0E-09
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 695 942 9.0E-09
sp|O46373|ADT1_RABIT ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 703 932 9.0E-09
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 695 845 1.0E-08
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 657 847 1.0E-08
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 676 861 1.0E-08
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 757 948 1.0E-08
sp|P32007|ADT3_BOVIN ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 708 932 1.0E-08
sp|Q75EP3|TPC1_ASHGO Mitochondrial thiamine pyrophosphate carrier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPC1 PE=3 SV=1 757 943 1.0E-08
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 772 929 1.0E-08
sp|Q6FTE5|TPC1_CANGA Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPC1 PE=3 SV=1 717 944 1.0E-08
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 760 956 2.0E-08
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 768 955 2.0E-08
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 697 847 2.0E-08
sp|P53320|MTM1_YEAST Mitochondrial carrier protein MTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTM1 PE=1 SV=1 792 946 2.0E-08
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 680 861 2.0E-08
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 854 950 2.0E-08
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 785 943 2.0E-08
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 676 850 2.0E-08
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 773 950 2.0E-08
sp|Q6Q0C1|S2547_HUMAN Solute carrier family 25 member 47 OS=Homo sapiens GN=SLC25A47 PE=2 SV=1 686 943 2.0E-08
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 717 943 2.0E-08
sp|Q6PH61|S2534_DANRE Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 693 937 2.0E-08
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 693 850 2.0E-08
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 772 888 2.0E-08
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 757 948 2.0E-08
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 673 855 3.0E-08
sp|Q9SB52|PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 657 851 3.0E-08
sp|Q6J329|S2547_RAT Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 708 847 3.0E-08
sp|Q9N2I9|UCP3_CANLF Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 772 928 3.0E-08
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 785 954 4.0E-08
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 699 926 4.0E-08
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 695 943 4.0E-08
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 693 850 4.0E-08
sp|A4RPU0|S2538_MAGO7 Solute carrier family 25 member 38 homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05623 PE=3 SV=1 711 943 4.0E-08
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 772 888 4.0E-08
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 858 946 5.0E-08
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 772 956 5.0E-08
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 676 850 5.0E-08
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 773 946 5.0E-08
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 703 923 5.0E-08
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 708 943 5.0E-08
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 771 947 6.0E-08
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 772 953 6.0E-08
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 768 954 6.0E-08
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 773 950 6.0E-08
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 708 937 6.0E-08
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 682 943 6.0E-08
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 678 854 7.0E-08
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 773 950 7.0E-08
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 671 847 8.0E-08
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 678 949 8.0E-08
sp|Q6J329|S2547_RAT Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 803 943 8.0E-08
sp|Q000K2|ADT2_TACAC ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 708 932 8.0E-08
sp|Q6IS41|S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 687 847 8.0E-08
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 772 950 9.0E-08
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 699 926 9.0E-08
sp|Q75EP3|TPC1_ASHGO Mitochondrial thiamine pyrophosphate carrier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPC1 PE=3 SV=1 680 943 9.0E-08
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 671 847 9.0E-08
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 772 951 1.0E-07
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 772 943 1.0E-07
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 772 951 1.0E-07
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 683 853 1.0E-07
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 695 943 1.0E-07
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 768 937 1.0E-07
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 773 950 1.0E-07
sp|P56501|UCP3_MOUSE Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 772 928 1.0E-07
sp|P56499|UCP3_RAT Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 772 928 1.0E-07
sp|Q18P97|UCP1_SUNMU Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 708 951 1.0E-07
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 679 861 2.0E-07
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 708 858 2.0E-07
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 766 952 2.0E-07
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 775 944 2.0E-07
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 678 949 2.0E-07
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 701 951 2.0E-07
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 781 953 2.0E-07
sp|Q2UU67|S2538_ASPOR Solute carrier family 25 member 38 homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090009000436 PE=3 SV=1 718 943 2.0E-07
sp|A5D9W9|S2538_PICGU Solute carrier family 25 member 38 homolog OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00074 PE=3 SV=2 690 943 2.0E-07
sp|P18239|ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 708 937 2.0E-07
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 678 939 2.0E-07
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 854 956 3.0E-07
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 708 845 3.0E-07
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 693 949 3.0E-07
sp|P31692|ADT_PARKE ADP,ATP carrier protein OS=Parachlorella kessleri PE=3 SV=1 681 929 3.0E-07
sp|Q6QRN9|ADT3_PIG ADP/ATP translocase 3 OS=Sus scrofa GN=SLC25A6 PE=2 SV=3 708 932 3.0E-07
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 771 953 3.0E-07
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 671 850 3.0E-07
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 722 942 3.0E-07
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 858 949 4.0E-07
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 766 948 4.0E-07
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 722 954 4.0E-07
sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 693 943 4.0E-07
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 763 887 4.0E-07
sp|Q55BF4|UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 772 942 4.0E-07
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 693 868 5.0E-07
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 657 850 5.0E-07
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 696 926 5.0E-07
sp|Q54W11|MCFL_DICDI Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 763 926 5.0E-07
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 696 949 5.0E-07
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 708 885 5.0E-07
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 858 946 6.0E-07
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 693 839 6.0E-07
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 708 943 6.0E-07
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 708 857 6.0E-07
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 766 949 7.0E-07
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 773 950 7.0E-07
sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 665 847 7.0E-07
sp|Q6IS41|S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 803 943 8.0E-07
sp|Q944H5|MTM1_ARATH Mitochondrial carrier protein MTM1 OS=Arabidopsis thaliana GN=MTM1 PE=2 SV=1 677 953 8.0E-07
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 683 856 9.0E-07
sp|Q06497|ANT1_YEAST Peroxisomal adenine nucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANT1 PE=1 SV=1 708 928 9.0E-07
sp|Q5SWT3|S2535_MOUSE Solute carrier family 25 member 35 OS=Mus musculus GN=Slc25a35 PE=1 SV=2 693 937 9.0E-07
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 763 943 1.0E-06
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 773 929 1.0E-06
sp|Q18P97|UCP1_SUNMU Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 708 861 1.0E-06
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 769 951 1.0E-06
sp|O13805|YE08_SCHPO Uncharacterized mitochondrial carrier C17H9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.08 PE=3 SV=1 681 947 1.0E-06
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 766 946 1.0E-06
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 717 949 1.0E-06
sp|A7F9Y3|S2538_SCLS1 Solute carrier family 25 member 38 homolog OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_14414 PE=3 SV=1 728 943 1.0E-06
sp|P04710|ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 699 937 1.0E-06
sp|Q6FTN2|DIC1_CANGA Mitochondrial dicarboxylate transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIC1 PE=3 SV=1 686 948 1.0E-06
sp|A6S8E0|S2538_BOTFB Solute carrier family 25 member 38 homolog OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_09631 PE=3 SV=1 726 956 1.0E-06
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 771 954 2.0E-06
sp|Q3TZX3|S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 693 854 2.0E-06
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 683 852 2.0E-06
sp|Q5U3V7|S2543_DANRE Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 685 857 2.0E-06
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 876 956 2.0E-06
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 693 852 2.0E-06
sp|Q9P7X9|YH66_SCHPO Uncharacterized mitochondrial carrier P23A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.06 PE=3 SV=1 747 950 2.0E-06
sp|B2VSU4|S2538_PYRTR Solute carrier family 25 member 38 homolog OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_00728 PE=3 SV=1 677 847 2.0E-06
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 708 847 2.0E-06
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 772 937 2.0E-06
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 696 926 2.0E-06
sp|P10861|UCP1_BOVIN Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 703 926 2.0E-06
sp|Q6Q0C1|S2547_HUMAN Solute carrier family 25 member 47 OS=Homo sapiens GN=SLC25A47 PE=2 SV=1 708 847 2.0E-06
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 671 850 2.0E-06
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 708 943 2.0E-06
sp|Q9Y619|ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 708 955 2.0E-06
sp|Q9WVD5|ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 684 955 2.0E-06
sp|O94370|YG04_SCHPO Uncharacterized mitochondrial carrier C1604.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.04 PE=3 SV=2 690 943 2.0E-06
sp|Q9ER18|UCP1_PHOSU Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 771 929 2.0E-06
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 771 954 3.0E-06
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 676 851 3.0E-06
sp|Q5RD81|GHC1_PONAB Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 768 891 3.0E-06
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 693 845 3.0E-06
sp|Q9M2Z8|MPCP2_ARATH Mitochondrial phosphate carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MPT2 PE=2 SV=1 784 943 3.0E-06
sp|P0C582|M2OM_NEUCR Putative mitochondrial 2-oxoglutarate/malate carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic-33 PE=3 SV=1 785 923 3.0E-06
sp|Q9UTD6|YID3_SCHPO Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.03c PE=3 SV=1 704 949 3.0E-06
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 677 845 4.0E-06
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 782 955 4.0E-06
sp|Q9FMU6|MPCP3_ARATH Mitochondrial phosphate carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=MPT3 PE=2 SV=1 722 948 4.0E-06
sp|Q6PH61|S2534_DANRE Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 677 862 5.0E-06
sp|Q55BF4|UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 693 949 5.0E-06
sp|Q54BF6|MCFN_DICDI Mitochondrial substrate carrier family protein N OS=Dictyostelium discoideum GN=mcfN PE=1 SV=2 701 927 5.0E-06
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 638 851 6.0E-06
sp|Q9SB52|PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 700 943 6.0E-06
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 695 943 6.0E-06
sp|Q01356|ARG13_NEUCR Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 708 949 6.0E-06
sp|Q7PQV7|ADT2_ANOGA ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 708 929 6.0E-06
sp|Q6CNY8|S2538_KLULA Solute carrier family 25 member 38 homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0E08911g PE=3 SV=1 726 943 6.0E-06
sp|A7TDX5|TPC1_VANPO Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 722 852 7.0E-06
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 772 951 7.0E-06
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 772 951 7.0E-06
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 772 947 7.0E-06
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 772 937 7.0E-06
sp|A4RPU0|S2538_MAGO7 Solute carrier family 25 member 38 homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05623 PE=3 SV=1 680 847 7.0E-06
sp|Q9Y619|ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 771 949 7.0E-06
sp|Q06143|DIC1_YEAST Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 711 943 7.0E-06
sp|Q9H936|GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 708 942 7.0E-06
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 653 823 8.0E-06
sp|Q2H608|S2538_CHAGB Solute carrier family 25 member 38 homolog OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05907 PE=3 SV=1 727 955 8.0E-06
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 678 845 9.0E-06
sp|Q8K404|UCP1_DICGR Mitochondrial brown fat uncoupling protein 1 OS=Dicrostonyx groenlandicus GN=UCP1 PE=2 SV=1 763 929 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006914 autophagy Yes
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0044248 cellular catabolic process No
GO:0009987 cellular process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0061919 process utilizing autophagic mechanism No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 121 143 22
3 296 318 22
4 385 407 22
5 414 433 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2876
MHWDSPTTQRQLQQDAVARPRPATRPKSLMTGLVAGSRREKSLWRWASTSNLDNFMRGVYQYYEGGGFWCILCAN
ALWLLETLFVAVLLTLLSQCVDYAALPHSKSLDQIIVRQCTRKMSGLWNTGIWLYSFFFIWKSAQYFLEIRRLLH
IRDFYLYLLEIPEQDMQTVSWQDVVARIMSLRDQNPKTATNMPQNVRRYLGSQSKDRLDAHDIANRLMRRDNYLI
AMINKDVLDLSLPIPFFRGKQLYSKTMEWYLHYSILDMAFNDFGQVRQDFLRADRRGQLSQKLKQRFYFAGLLNL
IFAPVVFAYVVIVYFFMYYNEYQKDPKLAAARKYTALAEWKFREFNELPHIFYERLHMSFPFATRYIDQFPKRMT
EDVARSIAFMSGAITAVLAVCTILDSELFLGFEITKDRTVLFYLGLFGGIWAMTRGIISEESTVFNPEYALRSVI
EYTHYMPDHWQGRLHSFEVKQEFSELYKMKVIIFLEEIMGIITTPLLLLFSLPNCSEQIVDFFREFTVHVDGLGY
VCSFAVFDFKKDGGAGVQPGGGHDVREEYYSTKHGKMAASYYGFIDNYVINPRTGIPGHMPPGMRQQFYPPPTFP
SLNSPTLAADMQGSHVGRLVESDHQPPAVSLGDSSRENSAVDMDEPEAGVLGMINQLRQTHHKHHRRGGVLYEAL
PPNFSLLQNMAAGAFAGIATRMQLLNPSSTTAYTGVLRSTYQIASGEGFFNLWRGMSSVIVGAGPAHAVYFATYE
AVKHAMGGNQAGVHHPLAAATSGAAATIASDAFMNPFDVIKQRMQIQNSSKMYRSMVDCAKFVYKNEGLAAFYVS
YPTTLSMTVPFTALQFLAYESLSTVMNPRKKYDPLTHCLAGAVAGGFAAALTTPMDVIKTILQTRGTSSDPEVRR
VNGFADGCRLLCRKEGFRGFFKGVRPRVVTTMPSTAICWSAYEFSKAYFIKRNDAL*
Coding >Ophun1|2876
ATGCACTGGGACAGTCCGACAACGCAGCGACAGCTGCAGCAAGATGCCGTGGCTCGTCCGCGGCCCGCCACTCGA
CCCAAATCACTGATGACGGGGCTCGTGGCTGGCAGCCGGCGCGAAAAGTCGCTCTGGAGGTGGGCCAGCACGTCA
AACTTGGACAACTTCATGCGAGGCGTATACCAGTATTACGAAGGAGGTGGCTTTTGGTGCATTCTCTGCGCCAAT
GCACTCTGGCTCTTGGAGACCTTATTCGTGGCTGTGCTTCTCACACTCCTTAGCCAATGCGTTGACTATGCCGCG
CTGCCTCACAGCAAATCTCTCGATCAAATCATTGTCAGGCAGTGCACGAGGAAGATGTCGGGCCTCTGGAACACG
GGTATCTGGCTGTACTCCTTTTTTTTCATATGGAAGTCGGCGCAATATTTCTTAGAGATCAGGCGACTCCTCCAT
ATCCGCGACTTTTATCTCTACCTCCTTGAGATTCCCGAGCAGGACATGCAGACAGTTTCATGGCAAGACGTTGTG
GCTCGGATCATGAGTCTTCGAGATCAAAACCCCAAGACGGCAACGAATATGCCGCAAAATGTGCGACGGTATCTC
GGCAGCCAGTCGAAAGATAGGTTAGACGCTCATGATATCGCAAATCGGCTAATGCGCAGAGATAACTACCTCATC
GCCATGATCAACAAGGATGTTCTCGACCTATCACTTCCGATTCCCTTTTTCCGGGGCAAGCAACTATATTCCAAG
ACGATGGAATGGTATCTGCATTACAGCATTCTTGACATGGCATTTAACGATTTTGGACAGGTGCGGCAAGATTTC
CTGAGAGCAGATCGAAGAGGTCAACTCAGCCAGAAGCTCAAGCAGCGGTTCTACTTTGCGGGACTGCTGAATCTT
ATTTTTGCGCCTGTGGTGTTCGCCTACGTAGTCATCGTCTACTTCTTCATGTATTACAATGAATATCAAAAGGAT
CCGAAATTAGCAGCTGCCCGAAAGTACACTGCGCTTGCGGAGTGGAAATTCCGGGAGTTCAACGAGTTGCCGCAT
ATCTTTTACGAAAGGTTGCACATGTCGTTCCCATTCGCAACGCGATACATAGATCAGTTCCCAAAGCGAATGACG
GAGGATGTTGCTCGAAGCATTGCTTTCATGTCCGGCGCAATCACGGCCGTGCTAGCAGTCTGCACCATTTTAGAC
TCGGAACTCTTCCTCGGTTTCGAGATCACGAAGGATCGAACAGTGTTGTTCTACCTAGGGTTGTTCGGAGGCATC
TGGGCCATGACACGTGGGATAATTTCTGAAGAATCGACCGTCTTCAATCCAGAGTACGCTCTGCGCAGTGTGATC
GAATACACCCATTACATGCCGGATCATTGGCAGGGTCGTCTACACAGCTTCGAAGTCAAGCAGGAATTTTCGGAA
CTCTACAAAATGAAAGTTATCATCTTCCTCGAGGAAATAATGGGCATCATCACGACACCATTGTTACTTTTGTTC
TCACTACCAAATTGCAGCGAGCAAATTGTCGACTTCTTCCGCGAGTTTACAGTACATGTCGACGGACTGGGCTAC
GTATGCTCATTCGCCGTTTTCGATTTCAAGAAGGACGGCGGCGCTGGAGTTCAACCCGGCGGCGGTCATGACGTT
AGAGAAGAATATTACTCGACAAAGCATGGGAAAATGGCCGCATCGTATTATGGCTTCATAGATAATTATGTCATC
AATCCGAGGACAGGTATTCCTGGACACATGCCGCCCGGCATGCGACAGCAATTCTACCCACCACCGACATTTCCG
AGCCTGAACTCGCCCACCCTGGCTGCGGATATGCAGGGCTCACATGTGGGCCGTCTTGTTGAGTCTGACCATCAG
CCGCCGGCGGTTAGTTTGGGGGATTCGAGCCGCGAAAACAGCGCGGTTGACATGGATGAGCCCGAAGCAGGAGTC
TTGGGAATGATCAACCAATTGCGGCAAACGCACCATAAACACCATCGGCGTGGAGGTGTTCTCTACGAAGCGCTC
CCCCCGAATTTTTCTCTGCTTCAGAACATGGCGGCCGGAGCCTTCGCTGGCATAGCCACTCGCATGCAGCTTCTC
AATCCCAGCTCAACAACGGCTTACACTGGAGTTTTGCGTAGCACCTACCAAATAGCATCTGGTGAGGGCTTCTTC
AACCTGTGGCGCGGCATGTCGAGCGTCATAGTCGGAGCAGGTCCTGCTCATGCCGTCTACTTCGCTACGTACGAA
GCGGTGAAGCATGCCATGGGAGGCAATCAAGCTGGGGTACACCATCCGCTCGCAGCTGCCACTAGCGGTGCCGCC
GCTACTATAGCCAGCGATGCCTTTATGAACCCCTTTGATGTCATCAAGCAGCGTATGCAAATTCAGAATTCGAGC
AAGATGTACCGCTCCATGGTCGATTGTGCCAAGTTTGTCTACAAGAACGAAGGCCTGGCAGCCTTCTACGTTTCC
TACCCGACCACCTTGTCTATGACAGTACCATTCACCGCGCTGCAATTTCTCGCTTACGAGTCCCTGTCGACAGTC
ATGAACCCTCGCAAGAAATACGACCCCCTGACACATTGCTTGGCGGGTGCTGTGGCAGGAGGCTTCGCCGCCGCA
CTCACGACTCCGATGGATGTGATTAAGACCATTTTGCAGACCCGTGGCACCTCATCAGACCCTGAAGTTCGCCGC
GTCAACGGGTTTGCCGACGGCTGCAGGCTACTATGTCGCAAAGAAGGCTTCCGTGGCTTCTTCAAAGGAGTTCGA
CCCAGAGTTGTCACTACCATGCCGAGCACTGCTATCTGCTGGTCAGCCTACGAATTTTCCAAAGCCTACTTCATA
AAACGCAACGATGCATTGTGA
Transcript >Ophun1|2876
ATGCACTGGGACAGTCCGACAACGCAGCGACAGCTGCAGCAAGATGCCGTGGCTCGTCCGCGGCCCGCCACTCGA
CCCAAATCACTGATGACGGGGCTCGTGGCTGGCAGCCGGCGCGAAAAGTCGCTCTGGAGGTGGGCCAGCACGTCA
AACTTGGACAACTTCATGCGAGGCGTATACCAGTATTACGAAGGAGGTGGCTTTTGGTGCATTCTCTGCGCCAAT
GCACTCTGGCTCTTGGAGACCTTATTCGTGGCTGTGCTTCTCACACTCCTTAGCCAATGCGTTGACTATGCCGCG
CTGCCTCACAGCAAATCTCTCGATCAAATCATTGTCAGGCAGTGCACGAGGAAGATGTCGGGCCTCTGGAACACG
GGTATCTGGCTGTACTCCTTTTTTTTCATATGGAAGTCGGCGCAATATTTCTTAGAGATCAGGCGACTCCTCCAT
ATCCGCGACTTTTATCTCTACCTCCTTGAGATTCCCGAGCAGGACATGCAGACAGTTTCATGGCAAGACGTTGTG
GCTCGGATCATGAGTCTTCGAGATCAAAACCCCAAGACGGCAACGAATATGCCGCAAAATGTGCGACGGTATCTC
GGCAGCCAGTCGAAAGATAGGTTAGACGCTCATGATATCGCAAATCGGCTAATGCGCAGAGATAACTACCTCATC
GCCATGATCAACAAGGATGTTCTCGACCTATCACTTCCGATTCCCTTTTTCCGGGGCAAGCAACTATATTCCAAG
ACGATGGAATGGTATCTGCATTACAGCATTCTTGACATGGCATTTAACGATTTTGGACAGGTGCGGCAAGATTTC
CTGAGAGCAGATCGAAGAGGTCAACTCAGCCAGAAGCTCAAGCAGCGGTTCTACTTTGCGGGACTGCTGAATCTT
ATTTTTGCGCCTGTGGTGTTCGCCTACGTAGTCATCGTCTACTTCTTCATGTATTACAATGAATATCAAAAGGAT
CCGAAATTAGCAGCTGCCCGAAAGTACACTGCGCTTGCGGAGTGGAAATTCCGGGAGTTCAACGAGTTGCCGCAT
ATCTTTTACGAAAGGTTGCACATGTCGTTCCCATTCGCAACGCGATACATAGATCAGTTCCCAAAGCGAATGACG
GAGGATGTTGCTCGAAGCATTGCTTTCATGTCCGGCGCAATCACGGCCGTGCTAGCAGTCTGCACCATTTTAGAC
TCGGAACTCTTCCTCGGTTTCGAGATCACGAAGGATCGAACAGTGTTGTTCTACCTAGGGTTGTTCGGAGGCATC
TGGGCCATGACACGTGGGATAATTTCTGAAGAATCGACCGTCTTCAATCCAGAGTACGCTCTGCGCAGTGTGATC
GAATACACCCATTACATGCCGGATCATTGGCAGGGTCGTCTACACAGCTTCGAAGTCAAGCAGGAATTTTCGGAA
CTCTACAAAATGAAAGTTATCATCTTCCTCGAGGAAATAATGGGCATCATCACGACACCATTGTTACTTTTGTTC
TCACTACCAAATTGCAGCGAGCAAATTGTCGACTTCTTCCGCGAGTTTACAGTACATGTCGACGGACTGGGCTAC
GTATGCTCATTCGCCGTTTTCGATTTCAAGAAGGACGGCGGCGCTGGAGTTCAACCCGGCGGCGGTCATGACGTT
AGAGAAGAATATTACTCGACAAAGCATGGGAAAATGGCCGCATCGTATTATGGCTTCATAGATAATTATGTCATC
AATCCGAGGACAGGTATTCCTGGACACATGCCGCCCGGCATGCGACAGCAATTCTACCCACCACCGACATTTCCG
AGCCTGAACTCGCCCACCCTGGCTGCGGATATGCAGGGCTCACATGTGGGCCGTCTTGTTGAGTCTGACCATCAG
CCGCCGGCGGTTAGTTTGGGGGATTCGAGCCGCGAAAACAGCGCGGTTGACATGGATGAGCCCGAAGCAGGAGTC
TTGGGAATGATCAACCAATTGCGGCAAACGCACCATAAACACCATCGGCGTGGAGGTGTTCTCTACGAAGCGCTC
CCCCCGAATTTTTCTCTGCTTCAGAACATGGCGGCCGGAGCCTTCGCTGGCATAGCCACTCGCATGCAGCTTCTC
AATCCCAGCTCAACAACGGCTTACACTGGAGTTTTGCGTAGCACCTACCAAATAGCATCTGGTGAGGGCTTCTTC
AACCTGTGGCGCGGCATGTCGAGCGTCATAGTCGGAGCAGGTCCTGCTCATGCCGTCTACTTCGCTACGTACGAA
GCGGTGAAGCATGCCATGGGAGGCAATCAAGCTGGGGTACACCATCCGCTCGCAGCTGCCACTAGCGGTGCCGCC
GCTACTATAGCCAGCGATGCCTTTATGAACCCCTTTGATGTCATCAAGCAGCGTATGCAAATTCAGAATTCGAGC
AAGATGTACCGCTCCATGGTCGATTGTGCCAAGTTTGTCTACAAGAACGAAGGCCTGGCAGCCTTCTACGTTTCC
TACCCGACCACCTTGTCTATGACAGTACCATTCACCGCGCTGCAATTTCTCGCTTACGAGTCCCTGTCGACAGTC
ATGAACCCTCGCAAGAAATACGACCCCCTGACACATTGCTTGGCGGGTGCTGTGGCAGGAGGCTTCGCCGCCGCA
CTCACGACTCCGATGGATGTGATTAAGACCATTTTGCAGACCCGTGGCACCTCATCAGACCCTGAAGTTCGCCGC
GTCAACGGGTTTGCCGACGGCTGCAGGCTACTATGTCGCAAAGAAGGCTTCCGTGGCTTCTTCAAAGGAGTTCGA
CCCAGAGTTGTCACTACCATGCCGAGCACTGCTATCTGCTGGTCAGCCTACGAATTTTCCAAAGCCTACTTCATA
AAACGCAACGATGCATTGTGA
Gene >Ophun1|2876
ATGCACTGGGACAGTCCGACAACGCAGCGACAGCTGCAGCAAGATGCCGTGGCTCGTCCGCGGCCCGCCACTCGA
CCCAAATCACTGATGACGGGGCTCGTGGCTGGCAGCCGGCGCGAAAAGTCGCTCTGGAGGTGGGCCAGCACGTCA
AACTTGGACAACTTCATGCGAGGCGTATACCAGTATTACGAAGGAGGTGGCTTTTGGTGCATTCTCTGCGCCAAT
GCACTCTGGCTCTTGTTAGTTCGATCCGGCGGTTGGTGTGACTCGGCTGACCGGTGCTTTGTAGGGAGACCTTAT
TCGTGGCTGTGCTTCTCACACTCCTTAGCCAATGCGTTGACTATGCCGCGCTGCCTCACAGCAAATCTCTCGATC
AAATCATTGTCAGGCAGTGCACGAGGAAGATGTCGGGCCTCTGGAACACGGGTATCTGGCTGTACTCCTTTTTTT
TCATATGGAAGTCGGCGCAATATTTCTTAGAGATCAGGCGACTCCTCCATATCCGCGACTTTTATCTCTACCTCC
TTGAGATTCCCGAGCAGGACATGCAGACAGTTTCATGGCAAGACGTTGTGGCTCGGATCATGAGTCTTCGAGATC
AAAACCCCAAGACGGCAACGAATATGCCGCAAAATGTGCGACGGTATCTCGGCAGCCAGTCGAAAGATAGGTTAG
ACGCTCATGATATCGCAAATCGGCTAATGCGCAGAGATAACTACCTCATCGCCATGATCAACAAGGATGTTCTCG
ACCTATCACTTCCGATTCCCTTTTTCCGGGGCAAGCAACTATATTCCAAGACGATGGAATGGTATCTGCATTACA
GCATTCTTGACATGGCATTTAACGATTTTGGACAGGTGCGGCAAGATTTCCTGAGAGCAGATCGAAGAGGTCAAC
TCAGCCAGAAGCTCAAGCAGCGGTTCTACTTTGCGGGACTGCTGAATCTTATTTTTGCGCCTGTGGTGTTCGCCT
ACGTAGTCATCGTCTACTTCTTCATGTATTACAATGTGAGTATTACACCAGCTTTGACGAAACTCCCAATAACAT
GGTACGTCAGGAATATCAAAAGGATCCGAAATTAGCAGCTGCCCGAAAGTACACTGCGCTTGCGGAGTGGAAATT
CCGGGAGTTCAACGAGTTGCCGCATATCTTTTACGAAAGGTTGCACATGTCGTTCCCATTCGCAACGCGATACAT
AGATCAGTTCCCAAAGCGAATGACGGAGGATGTTGCTCGAAGCATTGCTTTCATGTCCGGCGCAATCACGGCCGT
GCTAGCAGTCTGCACCATTTTAGACTCGGAACTCTTCCTCGGTTTCGAGATCACGAAGGATCGAACAGTGTTGTT
CTACCTAGGGTTGTTCGGAGGCATCTGGGCCATGACACGTGGGATAATTTCTGAAGAATCGACCGTCTTCAATCC
AGAGTACGCTCTGCGCAGTGTGATCGAATACACCCATTACATGCCGGATCATTGGCAGGGTCGTCTACACAGCTT
CGAAGTCAAGCAGGAATTTTCGGAACTCTACAAAATGAAAGTTATCATCTTCCTCGAGGAAATAATGGGCATCAT
CACGACACCATTGTTACTTTTGTTCTCACTACCAAATTGCAGCGAGCAAATTGTCGACTTCTTCCGCGAGTTTAC
AGTACATGTCGACGGACTGGGCTACGTATGCTCATTCGCCGTTTTCGATTTCAAGAAGGACGGCGGCGCTGGAGT
TCAACCCGGCGGCGGTCATGACGTTAGAGAAGAATATTACTCGACAAAGCATGGGAAAATGGCCGCATCGTATTA
TGGCTTCATAGATAATTATGTCATCAATCCGAGGACAGGTATTCCTGGACACATGCCGCCCGGCATGCGACAGCA
ATTCTACCCACCACCGACATTTCCGAGCCTGAACTCGCCCACCCTGGCTGCGGATATGCAGGGCTCACATGTGGG
CCGTCTTGTTGAGTCTGGTCGGACTAGAAGCAGGATGGTAGGGCTAAGTGGAAAGCGGGTAGCAAGGCGAGGGGG
ACACGCCATCGCACAACCATCTCCGATGGCATCTGTACTTCTCGACCCAGACCATCAGCCGCCGGCGGTTAGTTT
GGGGGTGAGAAGTGTGAATAACCCGCGGCATCACCGCGCCAGCTACCGTGGGGAAGATCAAATAATCGAAGAAAC
GGCTGAAGATAGGGATACCGAAGAGGAGCCGAGGCAAGGGGGCCATGTGCTAATGGAAGAATCCACATGGGAGAC
GTCGCCCGGCCAGGATTCGAGCCGCGAAAACAGCGCGGTTGACATGGATGAGCCCGAAGCAGGAGTCTTGGGAAT
GATCAACCAATTGCGGCAAACGCACCATAAACACCATCGGCGTGGAGGTGTTCTGTAGGTCATCGGCTCATAGCA
AAGGCTGTTGCACGAATTTTCGGCCTTGATCTCTCGTCGTCGGATATATGTTTATTAGTACATACATGTCAAAGC
GGCATTTCTCGAAGCCACGCATTCGTACGAATACTTAGTGTCAATTATGTTTCTACGAATAGATAGAAGGCATTA
AAGTAGAATAAGTAGGTCCAAATAGGTACCCCTAGGCAGATATTCGTAGATAGGTACCTATGTACGATACCTAGA
TAGGTATCTACCTGCCTACGAATACCTAGGTAGTAGGTATATATCTAGATTTTCCTTAGGTAGGCAGGCTGGGGG
TATTCAGAGGGACGGGAAGATAAGATGGATATTATCTAGGTATGTACGAATAGGTACTACCTACCTGCCTGGTGA
TCGTTCGTTCCCCCTGCCTGTGGCACCAAATTATTTAGGAGCACGTCGATTTGACCCCCCCACCCTACGGTGCTC
AAAAGCTCTACGGACACTGTCTCCCTACCGCCAGACCTCCAAAGCCGTCAACCAGGGCCCAATGCATCAGCGGGG
GTTTTTTTGCACTGGCAATCGACATCCTCGTCTGCGTCGCATATGCCTGCCACCTTTCATATCGCATCTGTCTGC
ATTCAAATGCTCCTAGCAAAAAAATCAACCGCACCATCCTGAGATCAGATATAGTCTCTCCGACGCCGACTCATC
TGCTATACGTCGCCAATCCGTCAATCAGACCCGTCGTCCTACTCGTCATCGGTTTGAAAAGGGGGGGGGGGGCGC
GGCTTTTCTCTGCCGTATCTGCCGACCTGGCTGCCTTCGATTGCGAGACCTCAGGCAGAGCTTCTCGAGCTGTGG
CCGAAATGGCCCAGCCAACTGCCGAGCCGGCCGAGGACTATGAGTGAGCGTTCAAGTTGCGCAATCTTCTTCACG
CCATGCTGACCTGCTTCCTTCTCTGCAGCTACGAAGCGCTCCCCCCGAATTTTTCTCTGCTTCAGAACATGGCGG
CCGGAGCCTTCGCTGGCATAGCCGTATGTCGCACTCGTCGAGCTCGAAGGCCAGAGCCGGGCTGATCAATGGTTC
TCAGGAGCACACTGTCATGTATCCCATCGATGCTATAAAGGCGAGCGACACCCATGTTTCCACCTGCACCACGTG
CATAGTCGCAAAAGCTGACCCAGGCGTGCTTCCAAAAGACTCGCATGCAGCTTCTCAATCCCAGCTCAACAACGG
CTTACACTGGAGTTTTGCGTAGCACCTACCAAATAGCATCTGGTGAGGGCTTCTTCAACCTGTGGCGCGGCATGT
CGAGCGTCATAGTCGGAGCAGGTAAGTAGCGGCCAGTCATTCCCTATTCGAGATCATGCCGGCTCTGCTCGTGCT
GTTCATCAGAATTCTTCCTCTCACGCATGTTCAGGTCCTGCTCATGCCGTCTACTTCGCTACGTACGAAGCGGTG
AAGCATGCCATGGGAGGCAATCAAGCTGGGGTACACCATCCGCTCGCAGCTGGTGCGTAACCCTCGGCTCGTTCC
GTGACGCCCCAGCCTTACATTCGACAGCCACTAGCGGTGCCGCCGCTACTATAGCCAGCGATGCCTTTATGAACC
CCTTTGATGGTGCGTGACCCGGCGGCTTTGGTTCTTTGCCGAGCTCACCAGAACGCAGTCATCAAGCAGCGTATG
CAAATTCAGAATTCGAGCAAGATGTACCGCTCCATGGTCGATTGTGCCAAGTTTGTCTACAAGAACGAAGGCCTG
GCAGCCTTCTACGTTTCCTACCCGACCACCTTGTCTATGACAGTACCATTCACCGCGCTGCAATTTCTCGCTTAC
GAGTCCCTGTCGACAGTCATGAACCCTCGCAAGAAATACGACCCCCTGACACATTGCTTGGCGGGTGCTGTGGCA
GGAGGCTTCGCCGCCGCACTCACGACTCCGATGGATGTGATTAAGACCATTTTGCAGACCCGTGGCACCTCATCA
GACCCTGAAGTTCGCCGCGTCAACGGGTTTGCCGACGGCTGCAGGCTACTATGTCGCAAAGAAGGCTTCCGTGGC
TTCTTCAAAGGAGTTCGACCCAGAGTTGTCACTACCATGCCGAGCACTGCTATCTGCTGGTCAGCCTACGAATTT
TCCAAGTAAGGACTTGTTATATCGGCTGGCGCGCAAGGCAGGTACTGACAGATCTTGCCAGAGCCTACTTCATAA
AACGCAACGATGCATTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail