Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2858
Gene name
LocationContig_254:5824..8296
Strand-
Gene length (bp)2472
Transcript length (bp)2472
Coding sequence length (bp)2472
Protein length (aa) 824

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 5.4E-10 758 817
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.5E-06 759 816

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36096|TUL1_YEAST Transmembrane E3 ubiquitin-protein ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUL1 PE=1 SV=1 255 823 2.0E-48
sp|O43085|DSC1_SCHPO DSC E3 ubiquitin ligase complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc1 PE=1 SV=2 352 823 2.0E-39

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 423 442 19
2 455 477 22
3 487 509 22
4 588 610 22
5 615 632 17
6 679 701 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2858
MPFGQHPVAGLVLLLLFLWMLFPESEYQSVAQSELAAGRLARYRDALDTLGASSWGDFAPDELHDATADTSDDSL
DPTSDAVPDAAPNATSHFLNLTGFRQVDGFAWEDLASFREKALRLSHHAIPLVAGRQLWDVAQGEAVWANASGTL
RGEWVRRPGSVARRYDSYNLSLSVPDMAWAGEHAEWARNMTGDAGRMTLRLEANRTVTTYDDMAPGTVPLSGGVI
RDVRGTVTVEDTNGSGHNWEMRLWGVHWPRQGVILMTTTSEKFEGIFGLPHLAPGPDFFLSSQSLLNSTLNSVIA
TKQQNINLDPNMPWNSDVDNMQYTAYPSPHCEFIMYAQVYPPIERASPAAGGTDGSEGIISAIEAELEHPLGAPI
GSVPRLKMSTVIYSPDCAFFLESKGPPDFPPMDSSHLVGMKTEVHLYQVQRWLIAFALVISFQVYLFKNQMKETF
TPSTMGRISFWTLSAMAVVDCMTFIAALTWMSSAGATFLPTLTLAFTSFASTLMVGCLLSKVHEVQLPEGRLRRE
AGPGDGGAVPTTTTTPPRTVPPASEPAPATSLLGFVTLPSDQDIGAEMAMTRLPSPQSFQNRLGRLLLFTLCITL
LAVSSSTWHPRARSFFLNLCAFAYLSMWVPQVYRNTMRNCRRAMRWPFVAGQTSLRLLPVAYFWIKEDNFLYART
DTTAFCVLLAWVWLQLAVLAVQEVMGPRFCVPVGWTPDGWDYHPVLGEDAIEAGSLPIGLVADDSRRRGSNASAK
RGNVRAIDCAICHEALEVPVLKAGDDEGSVASVFARRLYMMTPCRHIFHTHCLEGWMRVRLQCPICREDLPPI*
Coding >Ophun1|2858
ATGCCTTTCGGTCAGCATCCCGTCGCCGGCCTTGTCCTGCTACTTCTCTTTCTGTGGATGCTCTTCCCGGAGAGC
GAATATCAGTCAGTCGCCCAGTCCGAGCTCGCCGCCGGCCGGCTCGCGCGCTATCGGGATGCCCTCGATACCCTC
GGCGCTTCGTCCTGGGGCGACTTTGCGCCCGATGAGCTCCACGACGCTACTGCAGATACGAGCGATGACTCTCTC
GATCCCACTTCAGATGCCGTCCCCGACGCCGCTCCCAACGCCACCTCCCACTTTCTCAACCTCACCGGCTTTCGC
CAAGTCGACGGGTTCGCCTGGGAGGATCTCGCCAGCTTCCGCGAAAAGGCCTTGCGCCTCAGCCATCACGCCATA
CCCCTAGTTGCCGGCCGCCAGCTCTGGGACGTGGCACAGGGCGAGGCCGTCTGGGCCAACGCATCCGGCACCCTC
CGCGGCGAATGGGTTCGCCGCCCTGGCTCCGTCGCACGCCGCTACGACAGCTACAACTTGAGCCTCAGTGTCCCT
GACATGGCCTGGGCTGGTGAACACGCCGAATGGGCCCGCAATATGACGGGAGACGCGGGCCGCATGACGCTCCGC
CTCGAAGCTAACCGCACCGTGACTACATATGACGACATGGCCCCCGGCACAGTCCCTCTCTCCGGCGGCGTTATC
CGCGATGTTAGGGGCACCGTTACTGTCGAGGACACGAACGGGTCTGGTCACAACTGGGAGATGCGCCTCTGGGGG
GTTCATTGGCCGCGTCAGGGCGTCATCCTCATGACGACGACGAGCGAAAAGTTCGAGGGTATCTTTGGCCTGCCA
CACCTGGCTCCAGGTCCCGATTTCTTCCTTTCCAGTCAGTCGCTACTCAACAGCACGCTCAACAGTGTCATCGCC
ACAAAGCAACAGAACATAAACCTCGATCCTAATATGCCTTGGAACTCGGACGTCGACAACATGCAATACACGGCC
TACCCCTCGCCACACTGCGAATTCATCATGTACGCCCAGGTCTACCCGCCCATAGAACGCGCCTCACCTGCAGCC
GGCGGGACCGACGGCTCCGAAGGCATTATCAGCGCCATCGAAGCGGAGCTCGAGCACCCCTTGGGCGCGCCCATC
GGCTCCGTCCCGCGACTCAAGATGTCGACCGTCATCTACTCGCCTGATTGCGCATTCTTCCTCGAATCCAAGGGT
CCGCCTGACTTTCCGCCAATGGATAGCAGCCACTTGGTGGGCATGAAGACGGAGGTCCATCTCTATCAGGTCCAA
AGGTGGCTTATCGCCTTCGCCCTCGTCATCTCCTTTCAAGTATATCTATTCAAGAACCAGATGAAGGAGACGTTT
ACGCCCTCTACCATGGGACGCATCAGTTTCTGGACCCTGAGCGCTATGGCCGTCGTCGACTGCATGACGTTTATT
GCCGCCCTGACGTGGATGTCTTCGGCGGGCGCTACCTTTCTGCCGACGCTTACCCTCGCGTTTACATCTTTTGCG
TCGACGCTCATGGTCGGCTGCTTACTATCCAAGGTTCACGAGGTTCAACTGCCTGAGGGACGCCTTCGACGGGAG
GCCGGTCCGGGCGACGGCGGTGCGGTGCCGACGACGACGACGACTCCGCCGAGAACGGTGCCGCCGGCGTCCGAA
CCGGCGCCCGCGACGTCTCTCTTGGGGTTCGTGACGCTGCCTTCGGACCAGGATATCGGCGCCGAGATGGCGATG
ACGCGGCTGCCGTCGCCGCAGTCGTTTCAAAACCGGCTGGGCCGCTTGCTCCTCTTCACGCTGTGCATCACCCTG
CTGGCCGTGTCGTCATCGACGTGGCATCCTCGTGCGCGGTCTTTCTTCCTCAACCTGTGTGCCTTTGCCTACCTG
TCGATGTGGGTTCCGCAGGTCTATCGCAACACGATGCGAAACTGCCGACGGGCAATGAGGTGGCCGTTCGTGGCC
GGACAAACATCACTTCGGCTGCTGCCGGTGGCCTACTTCTGGATAAAGGAGGACAACTTCCTGTACGCGCGGACG
GACACGACGGCCTTTTGCGTTCTTTTGGCCTGGGTCTGGCTGCAGTTGGCGGTGTTGGCGGTTCAGGAGGTCATG
GGTCCGCGCTTCTGCGTGCCGGTCGGCTGGACTCCTGACGGGTGGGACTATCACCCCGTTCTGGGCGAGGACGCG
ATAGAGGCGGGCAGCCTGCCCATTGGACTGGTGGCGGACGATTCGCGGAGGCGAGGCAGCAACGCGTCGGCTAAG
CGCGGCAATGTGCGTGCCATCGACTGCGCCATCTGCCACGAGGCGCTCGAGGTGCCGGTGCTCAAGGCCGGCGAC
GACGAGGGCAGCGTGGCGAGCGTCTTTGCGAGGAGGCTGTACATGATGACGCCTTGCCGGCACATCTTCCACACG
CACTGCTTGGAGGGCTGGATGAGAGTCCGGCTGCAGTGTCCCATCTGTCGGGAGGATCTACCGCCGATATGA
Transcript >Ophun1|2858
ATGCCTTTCGGTCAGCATCCCGTCGCCGGCCTTGTCCTGCTACTTCTCTTTCTGTGGATGCTCTTCCCGGAGAGC
GAATATCAGTCAGTCGCCCAGTCCGAGCTCGCCGCCGGCCGGCTCGCGCGCTATCGGGATGCCCTCGATACCCTC
GGCGCTTCGTCCTGGGGCGACTTTGCGCCCGATGAGCTCCACGACGCTACTGCAGATACGAGCGATGACTCTCTC
GATCCCACTTCAGATGCCGTCCCCGACGCCGCTCCCAACGCCACCTCCCACTTTCTCAACCTCACCGGCTTTCGC
CAAGTCGACGGGTTCGCCTGGGAGGATCTCGCCAGCTTCCGCGAAAAGGCCTTGCGCCTCAGCCATCACGCCATA
CCCCTAGTTGCCGGCCGCCAGCTCTGGGACGTGGCACAGGGCGAGGCCGTCTGGGCCAACGCATCCGGCACCCTC
CGCGGCGAATGGGTTCGCCGCCCTGGCTCCGTCGCACGCCGCTACGACAGCTACAACTTGAGCCTCAGTGTCCCT
GACATGGCCTGGGCTGGTGAACACGCCGAATGGGCCCGCAATATGACGGGAGACGCGGGCCGCATGACGCTCCGC
CTCGAAGCTAACCGCACCGTGACTACATATGACGACATGGCCCCCGGCACAGTCCCTCTCTCCGGCGGCGTTATC
CGCGATGTTAGGGGCACCGTTACTGTCGAGGACACGAACGGGTCTGGTCACAACTGGGAGATGCGCCTCTGGGGG
GTTCATTGGCCGCGTCAGGGCGTCATCCTCATGACGACGACGAGCGAAAAGTTCGAGGGTATCTTTGGCCTGCCA
CACCTGGCTCCAGGTCCCGATTTCTTCCTTTCCAGTCAGTCGCTACTCAACAGCACGCTCAACAGTGTCATCGCC
ACAAAGCAACAGAACATAAACCTCGATCCTAATATGCCTTGGAACTCGGACGTCGACAACATGCAATACACGGCC
TACCCCTCGCCACACTGCGAATTCATCATGTACGCCCAGGTCTACCCGCCCATAGAACGCGCCTCACCTGCAGCC
GGCGGGACCGACGGCTCCGAAGGCATTATCAGCGCCATCGAAGCGGAGCTCGAGCACCCCTTGGGCGCGCCCATC
GGCTCCGTCCCGCGACTCAAGATGTCGACCGTCATCTACTCGCCTGATTGCGCATTCTTCCTCGAATCCAAGGGT
CCGCCTGACTTTCCGCCAATGGATAGCAGCCACTTGGTGGGCATGAAGACGGAGGTCCATCTCTATCAGGTCCAA
AGGTGGCTTATCGCCTTCGCCCTCGTCATCTCCTTTCAAGTATATCTATTCAAGAACCAGATGAAGGAGACGTTT
ACGCCCTCTACCATGGGACGCATCAGTTTCTGGACCCTGAGCGCTATGGCCGTCGTCGACTGCATGACGTTTATT
GCCGCCCTGACGTGGATGTCTTCGGCGGGCGCTACCTTTCTGCCGACGCTTACCCTCGCGTTTACATCTTTTGCG
TCGACGCTCATGGTCGGCTGCTTACTATCCAAGGTTCACGAGGTTCAACTGCCTGAGGGACGCCTTCGACGGGAG
GCCGGTCCGGGCGACGGCGGTGCGGTGCCGACGACGACGACGACTCCGCCGAGAACGGTGCCGCCGGCGTCCGAA
CCGGCGCCCGCGACGTCTCTCTTGGGGTTCGTGACGCTGCCTTCGGACCAGGATATCGGCGCCGAGATGGCGATG
ACGCGGCTGCCGTCGCCGCAGTCGTTTCAAAACCGGCTGGGCCGCTTGCTCCTCTTCACGCTGTGCATCACCCTG
CTGGCCGTGTCGTCATCGACGTGGCATCCTCGTGCGCGGTCTTTCTTCCTCAACCTGTGTGCCTTTGCCTACCTG
TCGATGTGGGTTCCGCAGGTCTATCGCAACACGATGCGAAACTGCCGACGGGCAATGAGGTGGCCGTTCGTGGCC
GGACAAACATCACTTCGGCTGCTGCCGGTGGCCTACTTCTGGATAAAGGAGGACAACTTCCTGTACGCGCGGACG
GACACGACGGCCTTTTGCGTTCTTTTGGCCTGGGTCTGGCTGCAGTTGGCGGTGTTGGCGGTTCAGGAGGTCATG
GGTCCGCGCTTCTGCGTGCCGGTCGGCTGGACTCCTGACGGGTGGGACTATCACCCCGTTCTGGGCGAGGACGCG
ATAGAGGCGGGCAGCCTGCCCATTGGACTGGTGGCGGACGATTCGCGGAGGCGAGGCAGCAACGCGTCGGCTAAG
CGCGGCAATGTGCGTGCCATCGACTGCGCCATCTGCCACGAGGCGCTCGAGGTGCCGGTGCTCAAGGCCGGCGAC
GACGAGGGCAGCGTGGCGAGCGTCTTTGCGAGGAGGCTGTACATGATGACGCCTTGCCGGCACATCTTCCACACG
CACTGCTTGGAGGGCTGGATGAGAGTCCGGCTGCAGTGTCCCATCTGTCGGGAGGATCTACCGCCGATATGA
Gene >Ophun1|2858
ATGCCTTTCGGTCAGCATCCCGTCGCCGGCCTTGTCCTGCTACTTCTCTTTCTGTGGATGCTCTTCCCGGAGAGC
GAATATCAGTCAGTCGCCCAGTCCGAGCTCGCCGCCGGCCGGCTCGCGCGCTATCGGGATGCCCTCGATACCCTC
GGCGCTTCGTCCTGGGGCGACTTTGCGCCCGATGAGCTCCACGACGCTACTGCAGATACGAGCGATGACTCTCTC
GATCCCACTTCAGATGCCGTCCCCGACGCCGCTCCCAACGCCACCTCCCACTTTCTCAACCTCACCGGCTTTCGC
CAAGTCGACGGGTTCGCCTGGGAGGATCTCGCCAGCTTCCGCGAAAAGGCCTTGCGCCTCAGCCATCACGCCATA
CCCCTAGTTGCCGGCCGCCAGCTCTGGGACGTGGCACAGGGCGAGGCCGTCTGGGCCAACGCATCCGGCACCCTC
CGCGGCGAATGGGTTCGCCGCCCTGGCTCCGTCGCACGCCGCTACGACAGCTACAACTTGAGCCTCAGTGTCCCT
GACATGGCCTGGGCTGGTGAACACGCCGAATGGGCCCGCAATATGACGGGAGACGCGGGCCGCATGACGCTCCGC
CTCGAAGCTAACCGCACCGTGACTACATATGACGACATGGCCCCCGGCACAGTCCCTCTCTCCGGCGGCGTTATC
CGCGATGTTAGGGGCACCGTTACTGTCGAGGACACGAACGGGTCTGGTCACAACTGGGAGATGCGCCTCTGGGGG
GTTCATTGGCCGCGTCAGGGCGTCATCCTCATGACGACGACGAGCGAAAAGTTCGAGGGTATCTTTGGCCTGCCA
CACCTGGCTCCAGGTCCCGATTTCTTCCTTTCCAGTCAGTCGCTACTCAACAGCACGCTCAACAGTGTCATCGCC
ACAAAGCAACAGAACATAAACCTCGATCCTAATATGCCTTGGAACTCGGACGTCGACAACATGCAATACACGGCC
TACCCCTCGCCACACTGCGAATTCATCATGTACGCCCAGGTCTACCCGCCCATAGAACGCGCCTCACCTGCAGCC
GGCGGGACCGACGGCTCCGAAGGCATTATCAGCGCCATCGAAGCGGAGCTCGAGCACCCCTTGGGCGCGCCCATC
GGCTCCGTCCCGCGACTCAAGATGTCGACCGTCATCTACTCGCCTGATTGCGCATTCTTCCTCGAATCCAAGGGT
CCGCCTGACTTTCCGCCAATGGATAGCAGCCACTTGGTGGGCATGAAGACGGAGGTCCATCTCTATCAGGTCCAA
AGGTGGCTTATCGCCTTCGCCCTCGTCATCTCCTTTCAAGTATATCTATTCAAGAACCAGATGAAGGAGACGTTT
ACGCCCTCTACCATGGGACGCATCAGTTTCTGGACCCTGAGCGCTATGGCCGTCGTCGACTGCATGACGTTTATT
GCCGCCCTGACGTGGATGTCTTCGGCGGGCGCTACCTTTCTGCCGACGCTTACCCTCGCGTTTACATCTTTTGCG
TCGACGCTCATGGTCGGCTGCTTACTATCCAAGGTTCACGAGGTTCAACTGCCTGAGGGACGCCTTCGACGGGAG
GCCGGTCCGGGCGACGGCGGTGCGGTGCCGACGACGACGACGACTCCGCCGAGAACGGTGCCGCCGGCGTCCGAA
CCGGCGCCCGCGACGTCTCTCTTGGGGTTCGTGACGCTGCCTTCGGACCAGGATATCGGCGCCGAGATGGCGATG
ACGCGGCTGCCGTCGCCGCAGTCGTTTCAAAACCGGCTGGGCCGCTTGCTCCTCTTCACGCTGTGCATCACCCTG
CTGGCCGTGTCGTCATCGACGTGGCATCCTCGTGCGCGGTCTTTCTTCCTCAACCTGTGTGCCTTTGCCTACCTG
TCGATGTGGGTTCCGCAGGTCTATCGCAACACGATGCGAAACTGCCGACGGGCAATGAGGTGGCCGTTCGTGGCC
GGACAAACATCACTTCGGCTGCTGCCGGTGGCCTACTTCTGGATAAAGGAGGACAACTTCCTGTACGCGCGGACG
GACACGACGGCCTTTTGCGTTCTTTTGGCCTGGGTCTGGCTGCAGTTGGCGGTGTTGGCGGTTCAGGAGGTCATG
GGTCCGCGCTTCTGCGTGCCGGTCGGCTGGACTCCTGACGGGTGGGACTATCACCCCGTTCTGGGCGAGGACGCG
ATAGAGGCGGGCAGCCTGCCCATTGGACTGGTGGCGGACGATTCGCGGAGGCGAGGCAGCAACGCGTCGGCTAAG
CGCGGCAATGTGCGTGCCATCGACTGCGCCATCTGCCACGAGGCGCTCGAGGTGCCGGTGCTCAAGGCCGGCGAC
GACGAGGGCAGCGTGGCGAGCGTCTTTGCGAGGAGGCTGTACATGATGACGCCTTGCCGGCACATCTTCCACACG
CACTGCTTGGAGGGCTGGATGAGAGTCCGGCTGCAGTGTCCCATCTGTCGGGAGGATCTACCGCCGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail