Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2857
Gene name
LocationContig_254:2717..5258
Strand+
Gene length (bp)2541
Transcript length (bp)2541
Coding sequence length (bp)2541
Protein length (aa) 847

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08124 Lyase_8_N Polysaccharide lyase family 8, N terminal alpha-helical domain 6.8E-79 60 377
PF02278 Lyase_8 Polysaccharide lyase family 8, super-sandwich domain 9.9E-69 421 691
PF02884 Lyase_8_C Polysaccharide lyase family 8, C-terminal beta-sandwich domain 2.0E-05 703 758

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CZ01|HYSA_PROAC Hyaluronate lyase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA0380 PE=3 SV=1 52 755 4.0E-97
sp|Q9AQS0|XANLY_BACGL Xanthan lyase OS=Bacillus sp. (strain GL1) GN=xly PE=1 SV=1 50 701 6.0E-95
sp|P0CZ00|HYSA_PROAA Hyaluronate lyase OS=Propionibacterium acnes PE=1 SV=1 52 755 9.0E-87
sp|Q54873|HYSA_STRPN Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_0314 PE=1 SV=2 115 710 3.0E-70
sp|Q59801|HYSA_STAA8 Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=hysA PE=3 SV=1 53 714 5.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CZ01|HYSA_PROAC Hyaluronate lyase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA0380 PE=3 SV=1 52 755 4.0E-97
sp|Q9AQS0|XANLY_BACGL Xanthan lyase OS=Bacillus sp. (strain GL1) GN=xly PE=1 SV=1 50 701 6.0E-95
sp|P0CZ00|HYSA_PROAA Hyaluronate lyase OS=Propionibacterium acnes PE=1 SV=1 52 755 9.0E-87
sp|Q54873|HYSA_STRPN Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_0314 PE=1 SV=2 115 710 3.0E-70
sp|Q59801|HYSA_STAA8 Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=hysA PE=3 SV=1 53 714 5.0E-67
sp|Q53591|HYSA_STRA3 Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=hylB PE=1 SV=2 45 689 3.0E-59
sp|Q59288|CSLA_PEDHD Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / NCIB 9290) GN=cslA PE=1 SV=1 76 784 5.0E-35
sp|C5G6D7|CABC2_BACT4 Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron GN=chonabc PE=1 SV=2 392 689 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0005576 extracellular region Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999333

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
PL8 1.7E-74 421 692

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5304
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1591
Ophiocordyceps camponoti-floridani Ophcf2|05083
Ophiocordyceps camponoti-rufipedis Ophun1|2857 (this protein)
Ophiocordyceps kimflemingae Ophio5|5202
Ophiocordyceps subramaniannii Hirsu2|4813

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2857
MRPSLLALASLIITKTLARPMQDNQTQSLPQPSEPCPESWNCTGCTSGHSHSFNKLRRRWRDMVLGVDLPVGSEP
FKSRLISLGRRAARFRNGFAPANGRLWPDLVYADDEQAESSAVTHSFRRLLVMALAWAQPGTGLTRDADLLSVIL
RGVDQLQQDVYHAEGEPYGNWWNWKVGIPEVLMDLCAVLHDQLGPRRIADLVAANDHFVPDSAIASYRSSSTGAN
RISQCRSVVFSGVFGKSVARLFRAREGLTPVFSLVTSGDGFYADGSFIQHRSIPYTGTYGAVLIDGFARLSALLA
GSKWAIQDDEFQRFLANVDRSFAPWIFHGLVMDGVSGRAVSRASDDHRRGHTIMDSILLLADSAPAAERARWMAM
VKGWIERDEYSPVWSDPTLSMAGLARFKSLADDQTITAAPEPETDHRLFAAMDRVVHRRPTWAASVSMSSIRTSF
YETGNGENLRGWHANSGMLYWWAASALNGSVHPGLGQYSDGFWPTVDPYRLPGTTVSRKPLADGAGGKWGAAMPD
DAEWVGGATDGEFGAGGQDVRGLESTLRGRKSWFFLGPAIVCLGTSLTSFDGELVETTYDNRNLGAASDSPFPLL
VVDGVPQPSMINTSMEILNASWAHLAGSGGYLFLDPRAVVAVREVRTGRWSDIDNSGSSKPIARRYFTLYRTHGR
DPFQSAYAYAVLPGASEDETRAAVGSVRIIQNEPLMHAAAGGNVFAANFFAPGRFGPLRVSEPCSVLIRGSTVYV
ADPIQAADVIEVVWRYEKRTATVRDKAGASVSVEFSASLLDSLLRPENQKFVPIETYAPHLYLWTFLRPKLSRLP
VVPRYELLIDVLPSLIGPNET*
Coding >Ophun1|2857
ATGCGCCCCTCACTCCTCGCCCTCGCCAGTCTCATCATCACCAAGACCCTGGCAAGACCAATGCAAGACAACCAA
ACACAATCCCTCCCACAACCATCAGAACCATGTCCCGAAAGCTGGAACTGCACGGGATGCACCTCCGGACACTCG
CACAGCTTCAACAAGCTCCGCCGCCGCTGGCGAGACATGGTACTCGGCGTCGATCTCCCCGTCGGCTCCGAGCCC
TTCAAGTCCCGACTCATCTCGCTCGGCCGGCGAGCAGCCCGATTCCGCAACGGCTTCGCTCCGGCTAATGGACGG
CTTTGGCCAGATCTCGTCTACGCAGACGATGAGCAGGCCGAGTCGTCGGCCGTGACGCATAGCTTCAGGAGGTTG
CTTGTCATGGCCCTCGCCTGGGCTCAGCCGGGAACCGGTCTCACCAGAGACGCTGACCTCCTGTCCGTCATCCTT
CGGGGCGTCGATCAGCTTCAGCAAGACGTCTACCACGCTGAGGGCGAGCCGTATGGCAACTGGTGGAACTGGAAG
GTCGGTATCCCGGAGGTGCTCATGGACCTTTGCGCCGTTCTTCACGATCAGCTCGGCCCTCGACGCATCGCAGAC
CTGGTAGCGGCCAACGACCACTTCGTGCCCGACTCTGCCATCGCCTCGTATCGATCTTCGAGCACAGGCGCCAAC
CGCATCAGCCAGTGCCGTTCCGTCGTCTTCTCCGGCGTCTTCGGAAAGTCGGTGGCCAGACTGTTCCGAGCCCGC
GAAGGCCTCACCCCCGTCTTCTCGCTCGTCACGTCTGGCGACGGCTTCTATGCCGACGGCTCCTTCATCCAGCAC
CGATCGATCCCATATACCGGAACATATGGCGCCGTCCTCATCGACGGTTTCGCTCGGCTTTCTGCCTTGCTGGCT
GGGTCGAAATGGGCCATCCAAGATGATGAGTTCCAGCGGTTTCTCGCCAACGTCGACCGTTCCTTTGCGCCTTGG
ATCTTTCACGGGCTCGTCATGGACGGCGTCTCGGGAAGGGCCGTCAGTAGGGCCAGCGACGACCACCGCCGCGGC
CACACCATCATGGACAGCATCCTGCTGCTGGCCGATAGCGCACCGGCCGCCGAACGCGCCCGCTGGATGGCCATG
GTCAAGGGCTGGATCGAGCGTGACGAATACTCGCCCGTCTGGTCCGACCCAACCTTGTCAATGGCCGGACTCGCC
CGCTTCAAGAGTCTGGCCGACGATCAGACCATCACCGCCGCACCGGAGCCCGAGACGGACCACCGGCTGTTTGCG
GCCATGGATCGGGTCGTCCACCGCCGTCCGACGTGGGCTGCCAGCGTCAGCATGTCCTCGATCCGCACCAGCTTC
TATGAGACGGGCAACGGTGAGAATCTGCGCGGCTGGCATGCCAACAGCGGCATGCTGTACTGGTGGGCGGCTTCG
GCCCTGAACGGCTCCGTCCACCCCGGTCTTGGCCAGTACTCGGACGGCTTCTGGCCCACCGTCGATCCTTACCGT
CTCCCCGGCACCACCGTCTCCCGAAAGCCGCTGGCGGACGGAGCCGGAGGCAAGTGGGGCGCCGCAATGCCGGAC
GACGCCGAGTGGGTCGGCGGCGCCACCGACGGCGAGTTCGGAGCCGGTGGCCAAGACGTACGGGGCCTGGAAAGC
ACCCTCCGTGGCCGCAAGTCATGGTTCTTCCTCGGGCCGGCCATCGTTTGCCTCGGAACCAGCTTGACGAGCTTC
GACGGTGAGCTGGTAGAGACGACGTATGATAATCGCAATCTCGGCGCCGCCTCCGACTCTCCGTTCCCGCTGCTG
GTTGTCGACGGTGTCCCGCAGCCGTCCATGATCAACACTTCGATGGAGATTCTCAACGCCAGCTGGGCCCATCTC
GCCGGCTCTGGAGGCTACCTCTTCCTCGATCCACGCGCCGTTGTCGCCGTCCGCGAGGTCCGCACCGGCCGCTGG
AGTGATATCGACAATTCTGGAAGCTCAAAGCCCATCGCCCGCCGCTACTTCACCCTTTACCGCACCCACGGCCGC
GATCCGTTCCAAAGCGCATACGCCTATGCCGTCTTGCCGGGTGCTTCCGAGGACGAGACCCGAGCCGCCGTGGGC
TCCGTCCGCATCATCCAGAACGAACCCCTGATGCATGCCGCCGCCGGGGGGAACGTCTTCGCTGCCAACTTCTTC
GCGCCCGGTAGATTCGGCCCGCTACGCGTCTCGGAACCCTGCAGCGTCTTGATCCGTGGCTCGACCGTCTATGTC
GCCGATCCGATTCAGGCCGCCGACGTGATAGAGGTCGTCTGGCGCTATGAGAAGCGGACTGCGACAGTCCGGGAT
AAAGCTGGCGCCTCCGTCTCCGTTGAGTTCTCTGCTTCCTTGCTAGATTCTTTACTGCGGCCTGAGAATCAAAAG
TTTGTTCCCATAGAAACGTATGCACCCCATCTTTACTTGTGGACATTCTTGAGACCCAAGCTGAGCAGGCTTCCT
GTCGTGCCAAGGTATGAACTTTTGATTGACGTGCTTCCGAGCTTGATAGGGCCCAACGAAACCTGA
Transcript >Ophun1|2857
ATGCGCCCCTCACTCCTCGCCCTCGCCAGTCTCATCATCACCAAGACCCTGGCAAGACCAATGCAAGACAACCAA
ACACAATCCCTCCCACAACCATCAGAACCATGTCCCGAAAGCTGGAACTGCACGGGATGCACCTCCGGACACTCG
CACAGCTTCAACAAGCTCCGCCGCCGCTGGCGAGACATGGTACTCGGCGTCGATCTCCCCGTCGGCTCCGAGCCC
TTCAAGTCCCGACTCATCTCGCTCGGCCGGCGAGCAGCCCGATTCCGCAACGGCTTCGCTCCGGCTAATGGACGG
CTTTGGCCAGATCTCGTCTACGCAGACGATGAGCAGGCCGAGTCGTCGGCCGTGACGCATAGCTTCAGGAGGTTG
CTTGTCATGGCCCTCGCCTGGGCTCAGCCGGGAACCGGTCTCACCAGAGACGCTGACCTCCTGTCCGTCATCCTT
CGGGGCGTCGATCAGCTTCAGCAAGACGTCTACCACGCTGAGGGCGAGCCGTATGGCAACTGGTGGAACTGGAAG
GTCGGTATCCCGGAGGTGCTCATGGACCTTTGCGCCGTTCTTCACGATCAGCTCGGCCCTCGACGCATCGCAGAC
CTGGTAGCGGCCAACGACCACTTCGTGCCCGACTCTGCCATCGCCTCGTATCGATCTTCGAGCACAGGCGCCAAC
CGCATCAGCCAGTGCCGTTCCGTCGTCTTCTCCGGCGTCTTCGGAAAGTCGGTGGCCAGACTGTTCCGAGCCCGC
GAAGGCCTCACCCCCGTCTTCTCGCTCGTCACGTCTGGCGACGGCTTCTATGCCGACGGCTCCTTCATCCAGCAC
CGATCGATCCCATATACCGGAACATATGGCGCCGTCCTCATCGACGGTTTCGCTCGGCTTTCTGCCTTGCTGGCT
GGGTCGAAATGGGCCATCCAAGATGATGAGTTCCAGCGGTTTCTCGCCAACGTCGACCGTTCCTTTGCGCCTTGG
ATCTTTCACGGGCTCGTCATGGACGGCGTCTCGGGAAGGGCCGTCAGTAGGGCCAGCGACGACCACCGCCGCGGC
CACACCATCATGGACAGCATCCTGCTGCTGGCCGATAGCGCACCGGCCGCCGAACGCGCCCGCTGGATGGCCATG
GTCAAGGGCTGGATCGAGCGTGACGAATACTCGCCCGTCTGGTCCGACCCAACCTTGTCAATGGCCGGACTCGCC
CGCTTCAAGAGTCTGGCCGACGATCAGACCATCACCGCCGCACCGGAGCCCGAGACGGACCACCGGCTGTTTGCG
GCCATGGATCGGGTCGTCCACCGCCGTCCGACGTGGGCTGCCAGCGTCAGCATGTCCTCGATCCGCACCAGCTTC
TATGAGACGGGCAACGGTGAGAATCTGCGCGGCTGGCATGCCAACAGCGGCATGCTGTACTGGTGGGCGGCTTCG
GCCCTGAACGGCTCCGTCCACCCCGGTCTTGGCCAGTACTCGGACGGCTTCTGGCCCACCGTCGATCCTTACCGT
CTCCCCGGCACCACCGTCTCCCGAAAGCCGCTGGCGGACGGAGCCGGAGGCAAGTGGGGCGCCGCAATGCCGGAC
GACGCCGAGTGGGTCGGCGGCGCCACCGACGGCGAGTTCGGAGCCGGTGGCCAAGACGTACGGGGCCTGGAAAGC
ACCCTCCGTGGCCGCAAGTCATGGTTCTTCCTCGGGCCGGCCATCGTTTGCCTCGGAACCAGCTTGACGAGCTTC
GACGGTGAGCTGGTAGAGACGACGTATGATAATCGCAATCTCGGCGCCGCCTCCGACTCTCCGTTCCCGCTGCTG
GTTGTCGACGGTGTCCCGCAGCCGTCCATGATCAACACTTCGATGGAGATTCTCAACGCCAGCTGGGCCCATCTC
GCCGGCTCTGGAGGCTACCTCTTCCTCGATCCACGCGCCGTTGTCGCCGTCCGCGAGGTCCGCACCGGCCGCTGG
AGTGATATCGACAATTCTGGAAGCTCAAAGCCCATCGCCCGCCGCTACTTCACCCTTTACCGCACCCACGGCCGC
GATCCGTTCCAAAGCGCATACGCCTATGCCGTCTTGCCGGGTGCTTCCGAGGACGAGACCCGAGCCGCCGTGGGC
TCCGTCCGCATCATCCAGAACGAACCCCTGATGCATGCCGCCGCCGGGGGGAACGTCTTCGCTGCCAACTTCTTC
GCGCCCGGTAGATTCGGCCCGCTACGCGTCTCGGAACCCTGCAGCGTCTTGATCCGTGGCTCGACCGTCTATGTC
GCCGATCCGATTCAGGCCGCCGACGTGATAGAGGTCGTCTGGCGCTATGAGAAGCGGACTGCGACAGTCCGGGAT
AAAGCTGGCGCCTCCGTCTCCGTTGAGTTCTCTGCTTCCTTGCTAGATTCTTTACTGCGGCCTGAGAATCAAAAG
TTTGTTCCCATAGAAACGTATGCACCCCATCTTTACTTGTGGACATTCTTGAGACCCAAGCTGAGCAGGCTTCCT
GTCGTGCCAAGGTATGAACTTTTGATTGACGTGCTTCCGAGCTTGATAGGGCCCAACGAAACCTGA
Gene >Ophun1|2857
ATGCGCCCCTCACTCCTCGCCCTCGCCAGTCTCATCATCACCAAGACCCTGGCAAGACCAATGCAAGACAACCAA
ACACAATCCCTCCCACAACCATCAGAACCATGTCCCGAAAGCTGGAACTGCACGGGATGCACCTCCGGACACTCG
CACAGCTTCAACAAGCTCCGCCGCCGCTGGCGAGACATGGTACTCGGCGTCGATCTCCCCGTCGGCTCCGAGCCC
TTCAAGTCCCGACTCATCTCGCTCGGCCGGCGAGCAGCCCGATTCCGCAACGGCTTCGCTCCGGCTAATGGACGG
CTTTGGCCAGATCTCGTCTACGCAGACGATGAGCAGGCCGAGTCGTCGGCCGTGACGCATAGCTTCAGGAGGTTG
CTTGTCATGGCCCTCGCCTGGGCTCAGCCGGGAACCGGTCTCACCAGAGACGCTGACCTCCTGTCCGTCATCCTT
CGGGGCGTCGATCAGCTTCAGCAAGACGTCTACCACGCTGAGGGCGAGCCGTATGGCAACTGGTGGAACTGGAAG
GTCGGTATCCCGGAGGTGCTCATGGACCTTTGCGCCGTTCTTCACGATCAGCTCGGCCCTCGACGCATCGCAGAC
CTGGTAGCGGCCAACGACCACTTCGTGCCCGACTCTGCCATCGCCTCGTATCGATCTTCGAGCACAGGCGCCAAC
CGCATCAGCCAGTGCCGTTCCGTCGTCTTCTCCGGCGTCTTCGGAAAGTCGGTGGCCAGACTGTTCCGAGCCCGC
GAAGGCCTCACCCCCGTCTTCTCGCTCGTCACGTCTGGCGACGGCTTCTATGCCGACGGCTCCTTCATCCAGCAC
CGATCGATCCCATATACCGGAACATATGGCGCCGTCCTCATCGACGGTTTCGCTCGGCTTTCTGCCTTGCTGGCT
GGGTCGAAATGGGCCATCCAAGATGATGAGTTCCAGCGGTTTCTCGCCAACGTCGACCGTTCCTTTGCGCCTTGG
ATCTTTCACGGGCTCGTCATGGACGGCGTCTCGGGAAGGGCCGTCAGTAGGGCCAGCGACGACCACCGCCGCGGC
CACACCATCATGGACAGCATCCTGCTGCTGGCCGATAGCGCACCGGCCGCCGAACGCGCCCGCTGGATGGCCATG
GTCAAGGGCTGGATCGAGCGTGACGAATACTCGCCCGTCTGGTCCGACCCAACCTTGTCAATGGCCGGACTCGCC
CGCTTCAAGAGTCTGGCCGACGATCAGACCATCACCGCCGCACCGGAGCCCGAGACGGACCACCGGCTGTTTGCG
GCCATGGATCGGGTCGTCCACCGCCGTCCGACGTGGGCTGCCAGCGTCAGCATGTCCTCGATCCGCACCAGCTTC
TATGAGACGGGCAACGGTGAGAATCTGCGCGGCTGGCATGCCAACAGCGGCATGCTGTACTGGTGGGCGGCTTCG
GCCCTGAACGGCTCCGTCCACCCCGGTCTTGGCCAGTACTCGGACGGCTTCTGGCCCACCGTCGATCCTTACCGT
CTCCCCGGCACCACCGTCTCCCGAAAGCCGCTGGCGGACGGAGCCGGAGGCAAGTGGGGCGCCGCAATGCCGGAC
GACGCCGAGTGGGTCGGCGGCGCCACCGACGGCGAGTTCGGAGCCGGTGGCCAAGACGTACGGGGCCTGGAAAGC
ACCCTCCGTGGCCGCAAGTCATGGTTCTTCCTCGGGCCGGCCATCGTTTGCCTCGGAACCAGCTTGACGAGCTTC
GACGGTGAGCTGGTAGAGACGACGTATGATAATCGCAATCTCGGCGCCGCCTCCGACTCTCCGTTCCCGCTGCTG
GTTGTCGACGGTGTCCCGCAGCCGTCCATGATCAACACTTCGATGGAGATTCTCAACGCCAGCTGGGCCCATCTC
GCCGGCTCTGGAGGCTACCTCTTCCTCGATCCACGCGCCGTTGTCGCCGTCCGCGAGGTCCGCACCGGCCGCTGG
AGTGATATCGACAATTCTGGAAGCTCAAAGCCCATCGCCCGCCGCTACTTCACCCTTTACCGCACCCACGGCCGC
GATCCGTTCCAAAGCGCATACGCCTATGCCGTCTTGCCGGGTGCTTCCGAGGACGAGACCCGAGCCGCCGTGGGC
TCCGTCCGCATCATCCAGAACGAACCCCTGATGCATGCCGCCGCCGGGGGGAACGTCTTCGCTGCCAACTTCTTC
GCGCCCGGTAGATTCGGCCCGCTACGCGTCTCGGAACCCTGCAGCGTCTTGATCCGTGGCTCGACCGTCTATGTC
GCCGATCCGATTCAGGCCGCCGACGTGATAGAGGTCGTCTGGCGCTATGAGAAGCGGACTGCGACAGTCCGGGAT
AAAGCTGGCGCCTCCGTCTCCGTTGAGTTCTCTGCTTCCTTGCTAGATTCTTTACTGCGGCCTGAGAATCAAAAG
TTTGTTCCCATAGAAACGTATGCACCCCATCTTTACTTGTGGACATTCTTGAGACCCAAGCTGAGCAGGCTTCCT
GTCGTGCCAAGGTATGAACTTTTGATTGACGTGCTTCCGAGCTTGATAGGGCCCAACGAAACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail