Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2856
Gene name
LocationContig_254:760..1838
Strand+
Gene length (bp)1078
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 1.4E-11 116 278

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0006810 transport No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 217 239 22
2 254 276 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5972
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05082
Ophiocordyceps camponoti-rufipedis Ophun1|2126
Ophiocordyceps camponoti-rufipedis Ophun1|2856 (this protein)
Ophiocordyceps kimflemingae Ophio5|5203
Ophiocordyceps kimflemingae Ophio5|5224
Ophiocordyceps kimflemingae Ophio5|5225

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2856
MAYSLRYPEYKSNDDEWTTRQSAVYHRLDLVSRTSLFILFSPTPDARAYSLIDAKLRASTVSEPLDTISLHEVFF
SAYLPAWRRYIASHERRFLPMANTTFATFIDEPLRVGYDNLSAMAGLETRFLAVSTMLSAAQQVLSEAATSFRQE
PLSRSSQADELDNLGRHCVAYGRAAAHLRQRAQTTGQLLAATLSLRDQVIAKEQNGSMLQLNKSAVFVTTLTLVY
APASFVASFFGMNFFAMDQLNSRIVATPMIWIYIVAITVFTAATVAFYYWLVKHDDVLFRRLAPKVGGPGWRSLA
RRFTKQGAGQEMEMQNGAVV*
Coding >Ophun1|2856
ATGGCCTATTCCCTCCGCTACCCGGAATACAAATCCAACGACGACGAATGGACCACCCGGCAGAGCGCAGTCTAC
CACCGCCTCGACCTCGTCTCTCGCACCAGCCTCTTCATCCTCTTCAGTCCAACGCCCGACGCTCGCGCCTACAGT
CTCATCGACGCCAAGCTCCGGGCTTCTACCGTCTCCGAGCCCTTGGATACCATCTCTCTACACGAAGTCTTCTTC
TCCGCTTACCTCCCGGCTTGGAGGCGGTACATTGCCTCGCACGAGAGACGCTTCCTCCCGATGGCAAACACCACC
TTCGCCACCTTCATAGACGAACCCCTAAGAGTAGGCTACGACAACCTCAGCGCCATGGCCGGTCTCGAAACCCGC
TTCCTCGCCGTATCAACCATGCTCTCCGCCGCCCAGCAAGTCCTCTCCGAAGCCGCCACCTCTTTCCGCCAGGAG
CCCCTATCCAGAAGCTCCCAAGCCGACGAGCTCGACAACCTTGGTCGTCACTGCGTTGCGTACGGGAGGGCGGCG
GCGCATTTGCGGCAGCGGGCGCAGACGACGGGGCAGTTGTTGGCTGCCACGCTTTCTCTCCGAGATCAGGTTATT
GCCAAGGAGCAGAATGGGAGTATGCTTCAGTTGAACAAGTCGGCTGTGTTTGTGACGACGTTGACGCTGGTGTAT
GCGCCGGCCTCGTTTGTTGCTTCCTTCTTCGGCATGAACTTCTTCGCAATGGACCAGCTCAACTCCCGCATCGTC
GCCACGCCAATGATATGGATCTACATCGTCGCCATCACCGTCTTCACAGCCGCAACCGTAGCCTTCTACTACTGG
CTCGTCAAGCACGACGACGTCCTCTTCCGCCGTCTGGCGCCAAAGGTCGGAGGCCCGGGCTGGAGATCGCTCGCT
CGCCGGTTCACCAAGCAGGGCGCGGGACAGGAGATGGAGATGCAGAACGGGGCGGTGGTTTGA
Transcript >Ophun1|2856
ATGGCCTATTCCCTCCGCTACCCGGAATACAAATCCAACGACGACGAATGGACCACCCGGCAGAGCGCAGTCTAC
CACCGCCTCGACCTCGTCTCTCGCACCAGCCTCTTCATCCTCTTCAGTCCAACGCCCGACGCTCGCGCCTACAGT
CTCATCGACGCCAAGCTCCGGGCTTCTACCGTCTCCGAGCCCTTGGATACCATCTCTCTACACGAAGTCTTCTTC
TCCGCTTACCTCCCGGCTTGGAGGCGGTACATTGCCTCGCACGAGAGACGCTTCCTCCCGATGGCAAACACCACC
TTCGCCACCTTCATAGACGAACCCCTAAGAGTAGGCTACGACAACCTCAGCGCCATGGCCGGTCTCGAAACCCGC
TTCCTCGCCGTATCAACCATGCTCTCCGCCGCCCAGCAAGTCCTCTCCGAAGCCGCCACCTCTTTCCGCCAGGAG
CCCCTATCCAGAAGCTCCCAAGCCGACGAGCTCGACAACCTTGGTCGTCACTGCGTTGCGTACGGGAGGGCGGCG
GCGCATTTGCGGCAGCGGGCGCAGACGACGGGGCAGTTGTTGGCTGCCACGCTTTCTCTCCGAGATCAGGTTATT
GCCAAGGAGCAGAATGGGAGTATGCTTCAGTTGAACAAGTCGGCTGTGTTTGTGACGACGTTGACGCTGGTGTAT
GCGCCGGCCTCGTTTGTTGCTTCCTTCTTCGGCATGAACTTCTTCGCAATGGACCAGCTCAACTCCCGCATCGTC
GCCACGCCAATGATATGGATCTACATCGTCGCCATCACCGTCTTCACAGCCGCAACCGTAGCCTTCTACTACTGG
CTCGTCAAGCACGACGACGTCCTCTTCCGCCGTCTGGCGCCAAAGGTCGGAGGCCCGGGCTGGAGATCGCTCGCT
CGCCGGTTCACCAAGCAGGGCGCGGGACAGGAGATGGAGATGCAGAACGGGGCGGTGGTTTGA
Gene >Ophun1|2856
ATGGCCTATTCCCTCCGCTACCCGGAATACAAATCCAACGACGACGAATGGACCACCCGGCAGAGCGCAGTCTAC
CACCGCCTCGACCTCGTCTCTCGCACCAGCCTCTTCATCCTCTTCAGTCCAACGCCCGACGCTCGCGCCTACAGT
CTCATCGACGCCAAGCTCCGGGCTTCTACCGTCTCCGAGCCCTTGGATACCATCTCTCTACACGAAGTCTTCTTC
TCCGCTTACCTCCCGGCTTGGAGGCGGTACATTGCCTCGCACGAGAGACGCTTCCTCCCGATGGTGAGTCTCTCA
TCTTTCCCCCCGTCAGCCAGCAGCTAAGAAAAGCATCGAGGCAAACACCACCTTCGCCACCTTCATAGACGAACC
CCTAAGAGTAGGCTACGACAACCTCAGCGCCATGGCCGGTCTCGAAACCCGCTTCCTCGCCGTATCAACCATGCT
CTCCGCCGCCCAGCAAGTCCTCTCCGAAGCCGCCACCTCTTTCCGCCAGGAGCCCCTATCCAGAAGCTCCCAAGC
CGACGAGCTCGACAACCTTGGTCGTCACTGCGTTGCGTACGGGAGGGCGGCGGCGCATTTGCGGCAGCGGGCGCA
GACGACGGGGCAGTTGTTGGCTGCCACGCTTTCTCTCCGAGATCAGGTTATTGCCAAGGAGCAGAATGGGAGTAT
GCTTCAGTTGAACAAGTCGGCTGTGTTTGTGACGACGTTGACGCTGGTGTATGCGCCGGCCTCGTTTGTTGCTGT
GAGTTGAGAGAGCCTTTCAAGTTGTCTCTGTCTCTCTGCATACGTTTGCTAACAATCTCAGTCCTTCTTCGGCAT
GAACTTCTTCGCAATGGACCAGCTCAACTCCCGCATCGTCGCCACGCCAATGATATGGATCTACATCGTCGCCAT
CACCGTCTTCACAGCCGCAACCGTAGCCTTCTACTACTGGCTCGTCAAGCACGACGACGTCCTCTTCCGCCGTCT
GGCGCCAAAGGTCGGAGGCCCGGGCTGGAGATCGCTCGCTCGCCGGTTCACCAAGCAGGGCGCGGGACAGGAGAT
GGAGATGCAGAACGGGGCGGTGGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail