Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2854
Gene name
LocationContig_253:19205..20687
Strand+
Gene length (bp)1482
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00191 Annexin Annexin 2.1E-19 158 222
PF00191 Annexin Annexin 5.7E-14 230 292
PF00191 Annexin Annexin 1.2E-17 316 377
PF00191 Annexin Annexin 2.6E-12 390 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P97384|ANX11_MOUSE Annexin A11 OS=Mus musculus GN=Anxa11 PE=1 SV=2 70 454 9.0E-65
sp|Q92125|ANXA7_XENLA Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1 15 456 2.0E-63
sp|P33477|ANX11_RABIT Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=1 SV=1 114 454 1.0E-60
sp|P20073|ANXA7_HUMAN Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3 89 459 2.0E-60
sp|P50995|ANX11_HUMAN Annexin A11 OS=Homo sapiens GN=ANXA11 PE=1 SV=1 110 454 1.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P97384|ANX11_MOUSE Annexin A11 OS=Mus musculus GN=Anxa11 PE=1 SV=2 70 454 9.0E-65
sp|Q92125|ANXA7_XENLA Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1 15 456 2.0E-63
sp|P33477|ANX11_RABIT Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=1 SV=1 114 454 1.0E-60
sp|P20073|ANXA7_HUMAN Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3 89 459 2.0E-60
sp|P50995|ANX11_HUMAN Annexin A11 OS=Homo sapiens GN=ANXA11 PE=1 SV=1 110 454 1.0E-59
sp|Q4R5L5|ANXA7_MACFA Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV=1 89 459 7.0E-59
sp|P20072|ANXA7_BOVIN Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2 93 459 9.0E-59
sp|Q07076|ANXA7_MOUSE Annexin A7 OS=Mus musculus GN=Anxa7 PE=1 SV=2 93 459 2.0E-57
sp|Q9VXG4|ANX11_DROME Annexin B11 OS=Drosophila melanogaster GN=AnxB11 PE=2 SV=2 136 459 3.0E-55
sp|P27214|ANX11_BOVIN Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1 104 454 2.0E-54
sp|P09525|ANXA4_HUMAN Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4 153 455 6.0E-51
sp|P50994|ANXA4_CANLF Annexin A4 OS=Canis lupus familiaris GN=ANXA4 PE=1 SV=2 139 454 4.0E-50
sp|P97429|ANXA4_MOUSE Annexin A4 OS=Mus musculus GN=Anxa4 PE=1 SV=4 153 455 1.0E-49
sp|P08132|ANXA4_PIG Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2 153 454 3.0E-49
sp|P13214|ANXA4_BOVIN Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2 153 454 1.0E-48
sp|Q4R4H7|ANXA5_MACFA Annexin A5 OS=Macaca fascicularis GN=ANXA5 PE=2 SV=3 153 456 2.0E-48
sp|P81287|ANXA5_BOVIN Annexin A5 OS=Bos taurus GN=ANXA5 PE=1 SV=3 153 456 2.0E-48
sp|Q5R1W0|ANXA5_PANTR Annexin A5 OS=Pan troglodytes GN=ANXA5 PE=2 SV=3 153 456 2.0E-48
sp|P08758|ANXA5_HUMAN Annexin A5 OS=Homo sapiens GN=ANXA5 PE=1 SV=2 153 456 2.0E-48
sp|Q29471|ANX13_CANLF Annexin A13 OS=Canis lupus familiaris GN=ANXA13 PE=1 SV=2 153 457 4.0E-48
sp|P14668|ANXA5_RAT Annexin A5 OS=Rattus norvegicus GN=Anxa5 PE=1 SV=3 153 456 8.0E-48
sp|P27216|ANX13_HUMAN Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3 153 457 9.0E-48
sp|P48036|ANXA5_MOUSE Annexin A5 OS=Mus musculus GN=Anxa5 PE=1 SV=1 153 456 2.0E-47
sp|P55260|ANXA4_RAT Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3 153 454 7.0E-47
sp|Q99JG3|ANX13_MOUSE Annexin A13 OS=Mus musculus GN=Anxa13 PE=1 SV=3 153 457 1.0E-46
sp|P17153|ANXA5_CHICK Annexin A5 OS=Gallus gallus GN=ANXA5 PE=1 SV=2 153 456 1.0E-45
sp|O97529|ANXA8_RABIT Annexin A8 OS=Oryctolagus cuniculus GN=ANXA8 PE=2 SV=1 153 457 4.0E-45
sp|O35640|ANXA8_MOUSE Annexin A8 OS=Mus musculus GN=Anxa8 PE=1 SV=2 153 457 8.0E-45
sp|Q5VT79|AXA81_HUMAN Annexin A8-like protein 1 OS=Homo sapiens GN=ANXA8L1 PE=2 SV=2 153 457 8.0E-44
sp|Q95L54|ANXA8_BOVIN Annexin A8 OS=Bos taurus GN=ANXA8 PE=2 SV=1 153 457 1.0E-43
sp|P13928|ANXA8_HUMAN Annexin A8 OS=Homo sapiens GN=ANXA8 PE=1 SV=3 153 457 1.0E-43
sp|P22464|ANXB9_DROME Annexin B9 OS=Drosophila melanogaster GN=AnxB9 PE=2 SV=2 153 458 6.0E-43
sp|P26256|ANX12_HYDVU Annexin-B12 OS=Hydra vulgaris GN=ANXB12 PE=1 SV=1 153 454 7.0E-43
sp|A5A6L7|ANXA8_PANTR Annexin A8 OS=Pan troglodytes GN=ANXA8 PE=2 SV=1 153 457 2.0E-42
sp|Q4FZU6|ANXA8_RAT Annexin A8 OS=Rattus norvegicus GN=Anxa8 PE=1 SV=1 153 457 2.0E-42
sp|P70075|ANXA5_CYNPY Annexin A5 OS=Cynops pyrrhogaster PE=2 SV=1 153 456 6.0E-42
sp|O35639|ANXA3_MOUSE Annexin A3 OS=Mus musculus GN=Anxa3 PE=1 SV=4 153 459 2.0E-41
sp|P08133|ANXA6_HUMAN Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3 153 455 1.0E-40
sp|P14824|ANXA6_MOUSE Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=3 153 455 7.0E-40
sp|P08133|ANXA6_HUMAN Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3 153 454 2.0E-39
sp|P14669|ANXA3_RAT Annexin A3 OS=Rattus norvegicus GN=Anxa3 PE=1 SV=4 153 454 4.0E-39
sp|Q3SWX7|ANXA3_BOVIN Annexin A3 OS=Bos taurus GN=ANXA3 PE=2 SV=3 153 454 5.0E-39
sp|P12429|ANXA3_HUMAN Annexin A3 OS=Homo sapiens GN=ANXA3 PE=1 SV=3 153 454 2.0E-38
sp|P22465|ANX10_DROME Annexin B10 OS=Drosophila melanogaster GN=AnxB10 PE=2 SV=3 141 457 2.0E-38
sp|P48037|ANXA6_RAT Annexin A6 OS=Rattus norvegicus GN=Anxa6 PE=1 SV=2 153 455 3.0E-38
sp|P79134|ANXA6_BOVIN Annexin A6 OS=Bos taurus GN=ANXA6 PE=1 SV=2 153 454 4.0E-38
sp|P79134|ANXA6_BOVIN Annexin A6 OS=Bos taurus GN=ANXA6 PE=1 SV=2 153 455 1.0E-37
sp|P14824|ANXA6_MOUSE Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=3 152 454 8.0E-37
sp|P48037|ANXA6_RAT Annexin A6 OS=Rattus norvegicus GN=Anxa6 PE=1 SV=2 153 454 2.0E-36
sp|P46193|ANXA1_BOVIN Annexin A1 OS=Bos taurus GN=ANXA1 PE=1 SV=2 153 455 5.0E-36
sp|P51901|ANXA6_CHICK Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1 153 454 2.0E-35
sp|Q8HZM6|ANXA1_HORSE Annexin A1 OS=Equus caballus GN=ANXA1 PE=2 SV=3 153 455 4.0E-34
sp|P19619|ANXA1_PIG Annexin A1 OS=Sus scrofa GN=ANXA1 PE=1 SV=3 153 455 7.0E-34
sp|P04083|ANXA1_HUMAN Annexin A1 OS=Homo sapiens GN=ANXA1 PE=1 SV=2 153 455 3.0E-33
sp|A5A6M2|ANXA1_PANTR Annexin A1 OS=Pan troglodytes GN=ANXA1 PE=2 SV=1 153 455 4.0E-33
sp|Q5REL2|ANXA1_PONAB Annexin A1 OS=Pongo abelii GN=ANXA1 PE=2 SV=1 153 455 6.0E-33
sp|P07356|ANXA2_MOUSE Annexin A2 OS=Mus musculus GN=Anxa2 PE=1 SV=2 139 454 1.0E-32
sp|A6NMY6|AXA2L_HUMAN Putative annexin A2-like protein OS=Homo sapiens GN=ANXA2P2 PE=5 SV=2 139 454 1.0E-32
sp|P24801|ANX2B_XENLA Annexin A2-B OS=Xenopus laevis GN=anxa2-b PE=2 SV=3 153 454 2.0E-32
sp|Q07936|ANXA2_RAT Annexin A2 OS=Rattus norvegicus GN=Anxa2 PE=1 SV=2 139 454 3.0E-32
sp|A2SW69|ANXA2_SHEEP Annexin A2 OS=Ovis aries GN=ANXA2 PE=1 SV=1 139 454 3.0E-32
sp|P04272|ANXA2_BOVIN Annexin A2 OS=Bos taurus GN=ANXA2 PE=1 SV=2 139 454 3.0E-32
sp|Q6TEQ7|ANXA2_CANLF Annexin A2 OS=Canis lupus familiaris GN=ANXA2 PE=1 SV=1 139 454 3.0E-32
sp|P17785|ANXA2_CHICK Annexin A2 OS=Gallus gallus GN=ANXA2 PE=1 SV=2 140 454 4.0E-32
sp|P51662|ANXA1_RABIT Annexin A1 OS=Oryctolagus cuniculus GN=ANXA1 PE=1 SV=1 153 455 6.0E-32
sp|Q5R5A0|ANXA2_PONAB Annexin A2 OS=Pongo abelii GN=ANXA2 PE=2 SV=1 139 454 8.0E-32
sp|P07355|ANXA2_HUMAN Annexin A2 OS=Homo sapiens GN=ANXA2 PE=1 SV=2 139 454 8.0E-32
sp|P19620|ANXA2_PIG Annexin A2 OS=Sus scrofa GN=ANXA2 PE=1 SV=4 133 454 8.0E-32
sp|P14087|ANXA1_CAVCU Annexin A1 OS=Cavia cutleri GN=ANXA1 PE=1 SV=1 153 455 2.0E-31
sp|P07150|ANXA1_RAT Annexin A1 OS=Rattus norvegicus GN=Anxa1 PE=1 SV=2 153 455 3.0E-31
sp|P27006|ANX2A_XENLA Annexin A2-A OS=Xenopus laevis GN=anxa2-a PE=2 SV=2 153 454 9.0E-31
sp|Q2Q1M6|ANXA2_CEREL Annexin A2 OS=Cervus elaphus GN=ANXA2 PE=2 SV=1 139 454 2.0E-30
sp|P51901|ANXA6_CHICK Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1 152 455 5.0E-30
sp|Q92040|ANX12_COLLI Annexin A1 isoform p37 OS=Columba livia GN=CP37 PE=1 SV=1 153 455 3.0E-29
sp|Q9QZ10|ANX10_MOUSE Annexin A10 OS=Mus musculus GN=Anxa10 PE=2 SV=2 153 458 3.0E-29
sp|P10107|ANXA1_MOUSE Annexin A1 OS=Mus musculus GN=Anxa1 PE=1 SV=2 153 455 6.0E-29
sp|Q9UJ72|ANX10_HUMAN Annexin A10 OS=Homo sapiens GN=ANXA10 PE=1 SV=3 153 458 1.0E-27
sp|P14950|ANX11_COLLI Annexin A1 isoform p35 OS=Columba livia GN=CP35 PE=2 SV=1 145 455 3.0E-26
sp|Q9C9X3|ANXD5_ARATH Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2 155 457 6.0E-26
sp|P24551|ANXA1_RODSP Annexin A1 OS=Rodentia sp. GN=ANXA1 PE=2 SV=3 153 455 1.0E-24
sp|Q94CK4|ANXD8_ARATH Annexin D8 OS=Arabidopsis thaliana GN=ANNAT8 PE=2 SV=2 153 457 1.0E-21
sp|Q9LX08|ANXD6_ARATH Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1 155 457 2.0E-20
sp|P97384|ANX11_MOUSE Annexin A11 OS=Mus musculus GN=Anxa11 PE=1 SV=2 228 457 2.0E-18
sp|P50995|ANX11_HUMAN Annexin A11 OS=Homo sapiens GN=ANXA11 PE=1 SV=1 228 457 2.0E-18
sp|P27214|ANX11_BOVIN Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1 228 457 4.0E-18
sp|Q9JHQ0|ANXA9_MOUSE Annexin A9 OS=Mus musculus GN=Anxa9 PE=2 SV=2 150 459 4.0E-18
sp|Q9LX07|ANXD7_ARATH Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1 155 457 6.0E-18
sp|P33477|ANX11_RABIT Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=1 SV=1 228 457 4.0E-17
sp|P55260|ANXA4_RAT Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3 210 457 9.0E-17
sp|Q3ZC08|ANXA9_BOVIN Annexin A9 OS=Bos taurus GN=ANXA9 PE=2 SV=1 150 459 1.0E-16
sp|P51074|ANX4_FRAAN Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2 155 457 2.0E-16
sp|P97429|ANXA4_MOUSE Annexin A4 OS=Mus musculus GN=Anxa4 PE=1 SV=4 218 457 1.0E-15
sp|Q9XEE2|ANXD2_ARATH Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=1 SV=1 155 457 1.0E-15
sp|O76027|ANXA9_HUMAN Annexin A9 OS=Homo sapiens GN=ANXA9 PE=1 SV=3 150 459 1.0E-15
sp|P13214|ANXA4_BOVIN Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2 230 457 3.0E-15
sp|Q9SE45|ANXD3_ARATH Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2 155 457 5.0E-15
sp|P17153|ANXA5_CHICK Annexin A5 OS=Gallus gallus GN=ANXA5 PE=1 SV=2 230 457 6.0E-15
sp|Q9SYT0|ANXD1_ARATH Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1 155 459 2.0E-14
sp|P50994|ANXA4_CANLF Annexin A4 OS=Canis lupus familiaris GN=ANXA4 PE=1 SV=2 230 457 4.0E-14
sp|P08132|ANXA4_PIG Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2 230 457 4.0E-14
sp|Q92125|ANXA7_XENLA Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1 313 459 9.0E-13
sp|P17785|ANXA2_CHICK Annexin A2 OS=Gallus gallus GN=ANXA2 PE=1 SV=2 314 455 2.0E-12
sp|P27006|ANX2A_XENLA Annexin A2-A OS=Xenopus laevis GN=anxa2-a PE=2 SV=2 312 455 2.0E-12
sp|P24801|ANX2B_XENLA Annexin A2-B OS=Xenopus laevis GN=anxa2-b PE=2 SV=3 150 377 3.0E-12
sp|P08133|ANXA6_HUMAN Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3 230 457 5.0E-12
sp|A2SW69|ANXA2_SHEEP Annexin A2 OS=Ovis aries GN=ANXA2 PE=1 SV=1 327 455 6.0E-12
sp|P04272|ANXA2_BOVIN Annexin A2 OS=Bos taurus GN=ANXA2 PE=1 SV=2 327 455 6.0E-12
sp|Q2Q1M6|ANXA2_CEREL Annexin A2 OS=Cervus elaphus GN=ANXA2 PE=2 SV=1 327 455 6.0E-12
sp|Q6TEQ7|ANXA2_CANLF Annexin A2 OS=Canis lupus familiaris GN=ANXA2 PE=1 SV=1 327 455 7.0E-12
sp|P48037|ANXA6_RAT Annexin A6 OS=Rattus norvegicus GN=Anxa6 PE=1 SV=2 230 457 8.0E-12
sp|Q5R5A0|ANXA2_PONAB Annexin A2 OS=Pongo abelii GN=ANXA2 PE=2 SV=1 327 455 9.0E-12
sp|P07355|ANXA2_HUMAN Annexin A2 OS=Homo sapiens GN=ANXA2 PE=1 SV=2 327 455 9.0E-12
sp|P19620|ANXA2_PIG Annexin A2 OS=Sus scrofa GN=ANXA2 PE=1 SV=4 327 455 9.0E-12
sp|P79134|ANXA6_BOVIN Annexin A6 OS=Bos taurus GN=ANXA6 PE=1 SV=2 230 457 2.0E-11
sp|P07356|ANXA2_MOUSE Annexin A2 OS=Mus musculus GN=Anxa2 PE=1 SV=2 327 455 2.0E-11
sp|A6NMY6|AXA2L_HUMAN Putative annexin A2-like protein OS=Homo sapiens GN=ANXA2P2 PE=5 SV=2 327 455 2.0E-11
sp|P14824|ANXA6_MOUSE Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=3 230 457 3.0E-11
sp|P70075|ANXA5_CYNPY Annexin A5 OS=Cynops pyrrhogaster PE=2 SV=1 230 457 6.0E-11
sp|P24801|ANX2B_XENLA Annexin A2-B OS=Xenopus laevis GN=anxa2-b PE=2 SV=3 312 455 6.0E-11
sp|Q8IXT5|RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens GN=RBM12B PE=1 SV=2 12 149 2.0E-10
sp|Q07936|ANXA2_RAT Annexin A2 OS=Rattus norvegicus GN=Anxa2 PE=1 SV=2 327 455 3.0E-10
sp|P27006|ANX2A_XENLA Annexin A2-A OS=Xenopus laevis GN=anxa2-a PE=2 SV=2 150 377 7.0E-10
sp|Q9XEE2|ANXD2_ARATH Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=1 SV=1 303 454 1.0E-09
sp|P70075|ANXA5_CYNPY Annexin A5 OS=Cynops pyrrhogaster PE=2 SV=1 312 457 2.0E-09
sp|P24551|ANXA1_RODSP Annexin A1 OS=Rodentia sp. GN=ANXA1 PE=2 SV=3 150 377 2.0E-08
sp|Q4I5I4|SPT5_GIBZE Transcription elongation factor SPT5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT5 PE=3 SV=1 58 144 6.0E-08
sp|Q9NFS4|ANXE1_GIAIN Annexin E1 OS=Giardia intestinalis GN=ANXE1 PE=1 SV=1 176 450 2.0E-07
sp|P09525|ANXA4_HUMAN Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4 313 458 1.0E-06
sp|P55260|ANXA4_RAT Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3 313 458 1.0E-06
sp|Q8IXT5|RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens GN=RBM12B PE=1 SV=2 12 137 1.0E-06
sp|Q8IXT5|RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens GN=RBM12B PE=1 SV=2 48 148 5.0E-06
sp|Q92108|ANXA1_CHICK Annexin A1 (Fragment) OS=Gallus gallus GN=ANXA1 PE=2 SV=1 153 243 5.0E-06
sp|P13214|ANXA4_BOVIN Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2 313 458 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005544 calcium-dependent phospholipid binding Yes
GO:0046872 metal ion binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4548
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1452
Ophiocordyceps australis map64 (Brazil) OphauB2|2310
Ophiocordyceps camponoti-floridani Ophcf2|07214
Ophiocordyceps camponoti-rufipedis Ophun1|2854 (this protein)
Ophiocordyceps kimflemingae Ophio5|2603
Ophiocordyceps subramaniannii Hirsu2|9511

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2854
MSYQGYGQPPPPPQGYGHYPPPSGGQYPPHGQHPPQQGGYHPSGQYPPQQAPYGQPPPGQYSQPTPGQYGQPPPG
QYSQPPPGQYGQPPPGQYGHPPPGQYGAPPSGNYGAPPPGQYGHPPPGQYGAPPPGQSPQAPRTPPSLGYGAPQI
IQWDPQPDVQALRSAMKGFGTDEKALIRILTNKDPLQMDLIRNTFGRSLNRDLIKDLKSETSGWFEKGLVQLARG
PLLTDVHYLQEAMAGPGTKEVVLNDVLLSRSNADLEAIKSAYHHTFHKSLVDAVKGELSMKTERHFLMVLSASRA
EDAAPVIPQQVEDDVTALYKATEGRAGTDELLVCDIMSHRNDNQIRAIAHRYQQRFNRDLEKVISSEFSGHMQDA
LLYQLRHATDKYMHAATLLEESMKGMGTKDHLLVSRVVRYHWDRNELANVKGAYQQRYGKTLGSRIKGETSGDYG
KLMLACIAE*
Coding >Ophun1|2854
ATGTCCTACCAAGGATACGGCCAACCGCCGCCACCGCCTCAGGGCTACGGCCACTATCCCCCGCCGTCTGGCGGA
CAGTACCCGCCTCATGGACAGCATCCTCCTCAGCAAGGAGGCTATCATCCGTCCGGTCAATACCCCCCGCAACAG
GCTCCGTATGGTCAACCTCCGCCCGGTCAGTACAGCCAACCTACGCCTGGTCAATACGGTCAACCTCCGCCTGGT
CAATACAGCCAACCTCCGCCCGGTCAGTACGGCCAACCGCCGCCCGGTCAGTACGGTCATCCCCCCCCAGGCCAG
TATGGTGCGCCTCCGTCCGGAAACTACGGCGCGCCTCCTCCCGGCCAGTATGGACATCCGCCCCCCGGCCAGTAT
GGCGCCCCGCCCCCCGGCCAGTCCCCTCAGGCTCCGCGGACTCCCCCGTCGCTTGGTTATGGCGCGCCGCAGATC
ATTCAGTGGGATCCGCAGCCGGATGTTCAGGCCCTGCGGAGCGCCATGAAAGGCTTCGGCACCGACGAAAAGGCG
CTCATTCGTATCCTGACGAACAAGGACCCTCTGCAGATGGACCTCATACGAAACACATTCGGTCGCTCGCTCAAC
CGCGACCTCATTAAGGATCTCAAGAGTGAGACGAGCGGCTGGTTCGAAAAGGGCTTGGTGCAGCTCGCCCGCGGC
CCCCTCTTGACGGATGTACACTATCTACAAGAGGCCATGGCAGGGCCCGGCACCAAGGAGGTCGTCCTTAATGAC
GTCTTGCTCTCTCGATCCAATGCCGATCTCGAAGCCATCAAGAGTGCGTACCATCACACTTTCCACAAGTCACTC
GTCGACGCCGTCAAGGGTGAACTGTCTATGAAGACGGAGCGGCACTTCCTCATGGTTCTGTCGGCCAGCCGAGCC
GAGGACGCTGCGCCGGTGATCCCACAGCAGGTCGAGGACGACGTCACAGCTTTGTACAAGGCGACGGAAGGAAGA
GCGGGCACCGACGAGCTCCTCGTATGCGACATCATGTCGCACCGAAACGACAATCAGATCCGTGCCATTGCCCAT
AGGTACCAGCAGAGGTTCAATCGCGATCTGGAAAAGGTTATTTCCTCGGAATTCTCGGGGCACATGCAAGACGCT
CTTCTGTACCAGCTGCGACATGCGACGGACAAGTACATGCACGCCGCGACGCTGCTCGAAGAGAGCATGAAAGGC
ATGGGAACTAAGGATCATCTGCTCGTCTCGCGTGTCGTCCGCTATCATTGGGACAGAAACGAACTGGCCAACGTC
AAGGGGGCCTATCAGCAAAGATACGGAAAGACGCTCGGCTCTCGCATTAAGGGCGAGACGTCGGGTGATTATGGC
AAGCTGATGCTGGCGTGTATCGCCGAATAG
Transcript >Ophun1|2854
ATGTCCTACCAAGGATACGGCCAACCGCCGCCACCGCCTCAGGGCTACGGCCACTATCCCCCGCCGTCTGGCGGA
CAGTACCCGCCTCATGGACAGCATCCTCCTCAGCAAGGAGGCTATCATCCGTCCGGTCAATACCCCCCGCAACAG
GCTCCGTATGGTCAACCTCCGCCCGGTCAGTACAGCCAACCTACGCCTGGTCAATACGGTCAACCTCCGCCTGGT
CAATACAGCCAACCTCCGCCCGGTCAGTACGGCCAACCGCCGCCCGGTCAGTACGGTCATCCCCCCCCAGGCCAG
TATGGTGCGCCTCCGTCCGGAAACTACGGCGCGCCTCCTCCCGGCCAGTATGGACATCCGCCCCCCGGCCAGTAT
GGCGCCCCGCCCCCCGGCCAGTCCCCTCAGGCTCCGCGGACTCCCCCGTCGCTTGGTTATGGCGCGCCGCAGATC
ATTCAGTGGGATCCGCAGCCGGATGTTCAGGCCCTGCGGAGCGCCATGAAAGGCTTCGGCACCGACGAAAAGGCG
CTCATTCGTATCCTGACGAACAAGGACCCTCTGCAGATGGACCTCATACGAAACACATTCGGTCGCTCGCTCAAC
CGCGACCTCATTAAGGATCTCAAGAGTGAGACGAGCGGCTGGTTCGAAAAGGGCTTGGTGCAGCTCGCCCGCGGC
CCCCTCTTGACGGATGTACACTATCTACAAGAGGCCATGGCAGGGCCCGGCACCAAGGAGGTCGTCCTTAATGAC
GTCTTGCTCTCTCGATCCAATGCCGATCTCGAAGCCATCAAGAGTGCGTACCATCACACTTTCCACAAGTCACTC
GTCGACGCCGTCAAGGGTGAACTGTCTATGAAGACGGAGCGGCACTTCCTCATGGTTCTGTCGGCCAGCCGAGCC
GAGGACGCTGCGCCGGTGATCCCACAGCAGGTCGAGGACGACGTCACAGCTTTGTACAAGGCGACGGAAGGAAGA
GCGGGCACCGACGAGCTCCTCGTATGCGACATCATGTCGCACCGAAACGACAATCAGATCCGTGCCATTGCCCAT
AGGTACCAGCAGAGGTTCAATCGCGATCTGGAAAAGGTTATTTCCTCGGAATTCTCGGGGCACATGCAAGACGCT
CTTCTGTACCAGCTGCGACATGCGACGGACAAGTACATGCACGCCGCGACGCTGCTCGAAGAGAGCATGAAAGGC
ATGGGAACTAAGGATCATCTGCTCGTCTCGCGTGTCGTCCGCTATCATTGGGACAGAAACGAACTGGCCAACGTC
AAGGGGGCCTATCAGCAAAGATACGGAAAGACGCTCGGCTCTCGCATTAAGGGCGAGACGTCGGGTGATTATGGC
AAGCTGATGCTGGCGTGTATCGCCGAATAG
Gene >Ophun1|2854
ATGTCCTACCAAGGATACGGCCGTCAGTTGCCCTCTGCTTCCGTCGTTACGCCCGATCTGACTTGTCCTCGCAGA
ACCGCCGCCACCGCCTCAGGGCTACGGCCACTATCCCCCGCCGTCTGGCGGACAGTACCCGCCTCATGGACAGCA
TCCTCCTCAGCAAGGAGGCTATCATCCGTCCGGTCAATACCCCCCGCAACAGGCTCCGTATGGTCAACCTCCGCC
CGGTCAGTACAGCCAACCTACGCCTGGTCAATACGGTCAACCTCCGCCTGGTCAATACAGCCAACCTCCGCCCGG
TCAGTACGGCCAACCGCCGCCCGGTCAGTACGGTCATCCCCCCCCAGGCCAGTATGGTGCGCCTCCGTCCGGAAA
CTACGGCGCGCCTCCTCCCGGCCAGTATGGACATCCGCCCCCCGGCCAGTATGGCGCCCCGCCCCCCGGCCAGTC
CCCTCAGGCTCCGCGGACTCCCCCGTCGCTTGGTTATGGCGCGCCGCAGATCATTCAGTGGGATCCGCAGCCGGA
TGTTCAGGCCCTGCGGAGCGCCATGAAAGGCTTCGGCACCGACGAAAAGGCGCTCATTCGTATCCTGACGAACAA
GGACCCTCTGCAGATGGACCTCATACGAAACACATTCGGTCGCTCGCTCAACCGCGACCTCATTAAGGATCTCAA
GAGTGAGACGAGCGGCTGGTTCGAAAAGGGCTTGGTGCAGCTCGCCCGCGGCCCCCTCTTGACGGATGTACACTA
TCTACAAGAGGCCATGGCAGGGCCCGGCACCAAGGAGGTCGTCCTTAATGACGTCTTGCTCTCTCGATCCAATGC
CGATCTCGAAGCCATCAAGAGTGCGTACCATCACACTTTCCACAAGTCACTCGTCGACGCCGTCAAGGGTGAACT
GTCTATGAAGACGGAGCGGCACTTCCTCATGGTTCTGTCGGCCAGCCGAGCCGAGGACGCTGCGCCGGTGATCCC
ACAGCAGGTCGAGGACGACGTCACAGCTTTGTACAAGGCGACGGAAGGAAGAGCGGGCACCGACGAGCTCCTCGT
ATGCGACATCATGTCGCACCGAAACGACAATCAGATCCGTGCCATTGCCCATAGGTACCAGCAGAGGTTCAATCG
CGATCTGGAAAAGGTTATTTCCTCGGTAAGAAGCCAACCCGAGACATGTTGAGGGCGCGAGCTGACGTCGTTTAG
GAATTCTCGGGGCACATGCAAGACGCTCTTCTGTACCAGCTGCGACATGCGACGGACAAGTACATGCACGCCGCG
ACGCTGCTCGAAGAGAGCATGAAAGGCATGGGAACTAAGGATCATCTGCTCGTCTCGCGTGTCGTCCGCTATCAT
TGGGACAGAAACGAACTGGCCAACGTCAAGGGGGCCTATCAGCAAAGATACGGAAAGACGCTCGGCTCTCGCATT
AAGGGCGAGACGTCGGGTGATTATGGCAAGCTGATGCTGGCGTGTATCGCCGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail