Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2842
Gene name
LocationContig_252:18545..21822
Strand+
Gene length (bp)3277
Transcript length (bp)2931
Coding sequence length (bp)2931
Protein length (aa) 977

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 1.1E-21 708 923

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 701 965 6.0E-32
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 701 965 8.0E-32
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 692 965 6.0E-27
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 689 965 4.0E-26
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 692 965 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 701 965 6.0E-32
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 701 965 8.0E-32
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 692 965 6.0E-27
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 689 965 4.0E-26
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 692 965 4.0E-26
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 700 965 1.0E-25
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 720 966 9.0E-25
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 701 972 1.0E-24
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 701 965 2.0E-24
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 700 965 3.0E-24
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 700 965 9.0E-24
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 702 965 1.0E-22
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 699 965 1.0E-22
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 700 965 3.0E-21
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 700 965 6.0E-21
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 692 975 6.0E-20
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 700 965 6.0E-20
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 701 976 6.0E-20
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 701 976 7.0E-20
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 701 976 2.0E-19
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 702 965 4.0E-19
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 788 965 2.0E-13
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 726 915 2.0E-08
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 705 952 7.0E-08
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 726 952 1.0E-07
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 705 952 2.0E-07
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 544 647 2.0E-07
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 703 940 4.0E-07
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 730 952 5.0E-07
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 552 647 2.0E-06
sp|Q9M9Q9|PER5_ARATH Peroxidase 5 OS=Arabidopsis thaliana GN=PER5 PE=3 SV=2 725 866 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0006979 response to oxidative stress Yes
GO:0004601 peroxidase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0016209 antioxidant activity No
GO:0006950 response to stress No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0008150 biological_process No
GO:0050896 response to stimulus No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2842
MKYTNAVTAMLLGLSTASPSKEMTAADYLERRQLNEPQISQGQQGSQQGFGQMGFGQLTGATFQPSLDQVTGTRD
FSAAGGLVAYDRHLMAKLQAAKAAKEQAAQGQAQGSRTKRDEVNKIREVNRVNRREHQLAASRDNHQEQPETQDS
KARVSRTKRDEISKVREANRVNKQEHQLPTSKDNRQEQLESSKVKVSRARASRTKKDGTSKVREVNKANKRHQIL
ATRKVRRRGQPEVSSRERVKDKASRASRALRGQRRLAASEIRGSFRGGVRVPSKLRARLLLGSSREGRRRLRRDD
GGSRGSKVSEVKLDSPDSLGSLESLGNLDSPVRQDSLDNLDSPDNLGNLGSLQSLESLESLESLESLDRQDRQDR
QDRQDSPVRQDNLDSPDRLVSLDSLDNPGSLGSLESLDNPGSLDSLDNPGSLGSLESLDNPGSLDSLDNPDSPDS
LVSLDSLVRLDRQVRQVRQVSPDSPDNLDNPDRQDNLDSPDRLVSLVSLDNPGSLDRQDRQDRQDRQVRQVRQDS
SRASKVNEDSRARVNVDIRVSRRNMDNEDSRTSQRSRDSKGLRELRGLRGLRGLKDHKGHKGHKGHKGHKGHKGH
KALRVLKALKALKALKALRGLRALKALKALKALKVLKAPKALKALRALAAALKAAALPPPSNSNPAAIKKMLLKD
IDGDDNTSFMAPVPPRDSAQCRQDTCCIWKYVAEEMRAAMTQQDGQCNDLARGCIRLGFHDAMDFSKTNNTNAGA
DGSIVLAGECETVADNNGLKNTCNQMRTWFAKYSPYGVGMADLIQMAANVGTVVCPLGPRVRTFVGRRDSTVRAP
DGNLPLFTDSNDHILALMDDKTISPFGLIALLGAHSTARARDAKPEIPGDHRLDSTPGVWDVAFYGEVLDNGTAT
ANLFKLDSDVNLSRDQRTSDSWRFFVGQQPGQFRWDKAYAAEYIRVSMLGVNNMNNLTECTGVLPPFIPNFGGIT
T*
Coding >Ophun1|2842
ATGAAGTACACCAACGCCGTCACGGCCATGCTGCTGGGCCTCTCAACCGCCAGCCCCAGCAAGGAGATGACGGCA
GCAGACTACCTAGAAAGACGACAACTCAACGAGCCGCAAATATCGCAGGGACAGCAGGGGAGCCAACAGGGCTTC
GGACAGATGGGCTTCGGCCAGCTTACGGGCGCTACCTTTCAGCCGAGTCTCGATCAGGTTACCGGGACGCGAGAC
TTTTCGGCAGCGGGGGGGCTGGTGGCGTATGATCGGCACTTGATGGCGAAGCTTCAGGCGGCGAAGGCGGCGAAG
GAGCAGGCTGCTCAGGGGCAGGCCCAGGGCAGCAGGACCAAAAGGGACGAGGTCAACAAGATCAGGGAAGTCAAC
AGGGTCAACAGGCGGGAACACCAACTAGCAGCCAGCAGGGACAATCACCAGGAGCAGCCAGAGACCCAGGACAGC
AAGGCCAGGGTCAGCAGAACAAAAAGGGACGAGATCAGCAAGGTCAGGGAGGCCAACAGGGTCAACAAGCAGGAA
CACCAACTGCCAACCAGCAAGGACAATCGCCAGGAGCAGCTAGAGAGCAGCAAGGTCAAGGTCAGCAGGGCCAGG
GCCAGCAGAACAAAAAAGGACGGGACCAGCAAAGTCAGGGAGGTCAACAAGGCCAACAAGCGGCATCAAATACTG
GCAACCCGCAAAGTCCGTCGGCGGGGGCAGCCAGAGGTCAGCAGCAGGGAGAGGGTCAAAGACAAGGCCAGCAGG
GCCAGCAGAGCCCTCAGGGGGCAACGCCGACTAGCAGCCAGCGAGATCAGGGGCAGCTTCAGGGGGGGAGTTCGG
GTGCCCAGCAAGCTGCGAGCTCGACTGTTGCTGGGGAGCAGCAGGGAAGGCCGACGGCGGCTGAGGAGGGACGAC
GGGGGCAGCAGGGGCAGCAAGGTGAGCGAGGTCAAGCTGGACAGCCCGGACAGCCTGGGCAGCCTGGAGAGCCTG
GGCAACCTGGACAGCCCGGTCAGGCAGGACAGCCTGGACAACCTGGACAGCCCGGACAACCTGGGCAACCTGGGC
AGCCTGCAGAGCCTGGAAAGCCTGGAGAGCCTGGAAAGCCTGGAGAGCCTGGACAGGCAGGACAGGCAGGACAGG
CAGGACAGGCAGGACAGCCCGGTCAGGCAGGACAACCTGGACAGCCCGGACCGCCTGGTCAGCCTGGACAGCCTG
GACAACCCGGGCAGCCTGGGCAGCCTGGAGAGCCTGGACAACCCGGGCAGCCTGGACAGCCTGGACAACCCGGGC
AGCCTGGGCAGCCTGGAGAGCCTGGACAACCCGGGCAGCCTGGACAGCCTGGACAACCCGGACAGCCCGGACAGC
CTGGTCAGCCTGGACAGCCTGGTCCGCCTGGACAGGCAGGTCAGGCAGGTCAGGCAGGTCAGCCCGGACAGCCCG
GACAACCTGGACAACCCGGACAGGCAGGACAACCTGGACAGCCCGGACCGCCTGGTCAGCCTGGTCAGCCTGGAC
AACCCGGGCAGCCTGGACAGGCAGGACAGGCAGGACAGGCAGGACAGGCAGGTCAGGCAGGTCAGGCAGGACAGC
AGCAGGGCCAGCAAGGTCAACGAGGACAGCAGAGCCAGGGTCAACGTGGACATCAGAGTCAGCAGGCGAAACATG
GACAACGAGGACAGCAGAACCAGCCAGCGCAGCAGAGACAGCAAGGGACTCAGGGAACTCAGGGGACTCAGGGGT
CTCAGGGGTCTCAAGGATCACAAGGGGCACAAGGGGCACAAGGGGCACAAGGGGCACAAGGGGCACAAGGGGCAC
AAGGCTCTCAGGGTTCTCAAGGCTCTCAAGGCTCTCAAGGCTCTCAAGGCTCTCAGGGGTCTCAGGGCTCTCAAG
GCTCTCAAGGCTCTCAAGGCTCTCAAGGTTCTCAAGGCTCCCAAGGCTCTCAAGGCTCTCAGGGCTCTGGCGGCG
GCCCTCAAGGCGGCGGCCCTCCCCCCCCCATCCAACTCCAACCCGGCGGCAATCAAGAAGATGCTCCTCAAAGAC
ATCGACGGCGACGACAACACGTCCTTCATGGCGCCCGTGCCCCCCCGGGACTCGGCGCAGTGCAGACAGGATACC
TGCTGTATCTGGAAGTACGTGGCCGAGGAGATGAGGGCGGCCATGACGCAGCAGGACGGCCAGTGCAATGATCTT
GCTCGAGGTTGTATCCGTCTCGGCTTCCATGATGCCATGGACTTTTCCAAGACGAACAACACCAATGCTGGAGCG
GATGGATCCATCGTCCTGGCCGGAGAGTGCGAGACGGTAGCAGACAACAACGGACTCAAAAACACGTGCAACCAG
ATGAGAACCTGGTTCGCAAAGTATTCCCCCTACGGCGTCGGAATGGCAGACCTCATCCAAATGGCGGCCAACGTC
GGAACAGTCGTCTGTCCCCTCGGCCCCCGAGTCCGGACCTTTGTCGGACGCCGAGACAGCACCGTCCGAGCCCCA
GACGGAAACCTCCCTCTCTTCACCGACAGCAACGACCACATCCTCGCCCTCATGGACGACAAGACCATCTCCCCC
TTTGGCCTCATCGCCCTGCTGGGCGCCCACTCCACGGCCCGTGCCCGCGACGCGAAGCCGGAGATTCCGGGGGAT
CATCGTCTGGATTCGACGCCGGGGGTGTGGGATGTTGCGTTTTACGGTGAGGTTTTGGATAATGGTACGGCGACT
GCGAATTTGTTTAAGCTGGATAGTGATGTGAACCTCAGTCGGGATCAGAGGACGAGTGATTCTTGGAGGTTCTTT
GTTGGGCAGCAGCCGGGGCAATTCCGGTGGGACAAGGCTTACGCGGCTGAGTATATTCGCGTCAGCATGCTGGGC
GTCAACAACATGAACAACCTGACCGAGTGCACGGGGGTGCTGCCGCCGTTCATCCCCAACTTCGGGGGGATTACG
ACGTAG
Transcript >Ophun1|2842
ATGAAGTACACCAACGCCGTCACGGCCATGCTGCTGGGCCTCTCAACCGCCAGCCCCAGCAAGGAGATGACGGCA
GCAGACTACCTAGAAAGACGACAACTCAACGAGCCGCAAATATCGCAGGGACAGCAGGGGAGCCAACAGGGCTTC
GGACAGATGGGCTTCGGCCAGCTTACGGGCGCTACCTTTCAGCCGAGTCTCGATCAGGTTACCGGGACGCGAGAC
TTTTCGGCAGCGGGGGGGCTGGTGGCGTATGATCGGCACTTGATGGCGAAGCTTCAGGCGGCGAAGGCGGCGAAG
GAGCAGGCTGCTCAGGGGCAGGCCCAGGGCAGCAGGACCAAAAGGGACGAGGTCAACAAGATCAGGGAAGTCAAC
AGGGTCAACAGGCGGGAACACCAACTAGCAGCCAGCAGGGACAATCACCAGGAGCAGCCAGAGACCCAGGACAGC
AAGGCCAGGGTCAGCAGAACAAAAAGGGACGAGATCAGCAAGGTCAGGGAGGCCAACAGGGTCAACAAGCAGGAA
CACCAACTGCCAACCAGCAAGGACAATCGCCAGGAGCAGCTAGAGAGCAGCAAGGTCAAGGTCAGCAGGGCCAGG
GCCAGCAGAACAAAAAAGGACGGGACCAGCAAAGTCAGGGAGGTCAACAAGGCCAACAAGCGGCATCAAATACTG
GCAACCCGCAAAGTCCGTCGGCGGGGGCAGCCAGAGGTCAGCAGCAGGGAGAGGGTCAAAGACAAGGCCAGCAGG
GCCAGCAGAGCCCTCAGGGGGCAACGCCGACTAGCAGCCAGCGAGATCAGGGGCAGCTTCAGGGGGGGAGTTCGG
GTGCCCAGCAAGCTGCGAGCTCGACTGTTGCTGGGGAGCAGCAGGGAAGGCCGACGGCGGCTGAGGAGGGACGAC
GGGGGCAGCAGGGGCAGCAAGGTGAGCGAGGTCAAGCTGGACAGCCCGGACAGCCTGGGCAGCCTGGAGAGCCTG
GGCAACCTGGACAGCCCGGTCAGGCAGGACAGCCTGGACAACCTGGACAGCCCGGACAACCTGGGCAACCTGGGC
AGCCTGCAGAGCCTGGAAAGCCTGGAGAGCCTGGAAAGCCTGGAGAGCCTGGACAGGCAGGACAGGCAGGACAGG
CAGGACAGGCAGGACAGCCCGGTCAGGCAGGACAACCTGGACAGCCCGGACCGCCTGGTCAGCCTGGACAGCCTG
GACAACCCGGGCAGCCTGGGCAGCCTGGAGAGCCTGGACAACCCGGGCAGCCTGGACAGCCTGGACAACCCGGGC
AGCCTGGGCAGCCTGGAGAGCCTGGACAACCCGGGCAGCCTGGACAGCCTGGACAACCCGGACAGCCCGGACAGC
CTGGTCAGCCTGGACAGCCTGGTCCGCCTGGACAGGCAGGTCAGGCAGGTCAGGCAGGTCAGCCCGGACAGCCCG
GACAACCTGGACAACCCGGACAGGCAGGACAACCTGGACAGCCCGGACCGCCTGGTCAGCCTGGTCAGCCTGGAC
AACCCGGGCAGCCTGGACAGGCAGGACAGGCAGGACAGGCAGGACAGGCAGGTCAGGCAGGTCAGGCAGGACAGC
AGCAGGGCCAGCAAGGTCAACGAGGACAGCAGAGCCAGGGTCAACGTGGACATCAGAGTCAGCAGGCGAAACATG
GACAACGAGGACAGCAGAACCAGCCAGCGCAGCAGAGACAGCAAGGGACTCAGGGAACTCAGGGGACTCAGGGGT
CTCAGGGGTCTCAAGGATCACAAGGGGCACAAGGGGCACAAGGGGCACAAGGGGCACAAGGGGCACAAGGGGCAC
AAGGCTCTCAGGGTTCTCAAGGCTCTCAAGGCTCTCAAGGCTCTCAAGGCTCTCAGGGGTCTCAGGGCTCTCAAG
GCTCTCAAGGCTCTCAAGGCTCTCAAGGTTCTCAAGGCTCCCAAGGCTCTCAAGGCTCTCAGGGCTCTGGCGGCG
GCCCTCAAGGCGGCGGCCCTCCCCCCCCCATCCAACTCCAACCCGGCGGCAATCAAGAAGATGCTCCTCAAAGAC
ATCGACGGCGACGACAACACGTCCTTCATGGCGCCCGTGCCCCCCCGGGACTCGGCGCAGTGCAGACAGGATACC
TGCTGTATCTGGAAGTACGTGGCCGAGGAGATGAGGGCGGCCATGACGCAGCAGGACGGCCAGTGCAATGATCTT
GCTCGAGGTTGTATCCGTCTCGGCTTCCATGATGCCATGGACTTTTCCAAGACGAACAACACCAATGCTGGAGCG
GATGGATCCATCGTCCTGGCCGGAGAGTGCGAGACGGTAGCAGACAACAACGGACTCAAAAACACGTGCAACCAG
ATGAGAACCTGGTTCGCAAAGTATTCCCCCTACGGCGTCGGAATGGCAGACCTCATCCAAATGGCGGCCAACGTC
GGAACAGTCGTCTGTCCCCTCGGCCCCCGAGTCCGGACCTTTGTCGGACGCCGAGACAGCACCGTCCGAGCCCCA
GACGGAAACCTCCCTCTCTTCACCGACAGCAACGACCACATCCTCGCCCTCATGGACGACAAGACCATCTCCCCC
TTTGGCCTCATCGCCCTGCTGGGCGCCCACTCCACGGCCCGTGCCCGCGACGCGAAGCCGGAGATTCCGGGGGAT
CATCGTCTGGATTCGACGCCGGGGGTGTGGGATGTTGCGTTTTACGGTGAGGTTTTGGATAATGGTACGGCGACT
GCGAATTTGTTTAAGCTGGATAGTGATGTGAACCTCAGTCGGGATCAGAGGACGAGTGATTCTTGGAGGTTCTTT
GTTGGGCAGCAGCCGGGGCAATTCCGGTGGGACAAGGCTTACGCGGCTGAGTATATTCGCGTCAGCATGCTGGGC
GTCAACAACATGAACAACCTGACCGAGTGCACGGGGGTGCTGCCGCCGTTCATCCCCAACTTCGGGGGGATTACG
ACGTAG
Gene >Ophun1|2842
ATGAAGTACACCAACGCCGTCACGGCCATGCTGCTGGGCCTCTCAACCGCCAGCCCCAGCAAGGAGATGACGGCA
GCAGACTACCTAGAAAGACGACAACTCAACGAGCCGCAAATATCGCAGGGACAGCAGGGGAGCCAACAGGGCTTC
GGACAGATGGGCTTCGGCCAGCTTACGGGCGCTACCTTTCAGCCGAGTCTCGATCAGGTTACCGGGACGCGAGAC
TTTTCGGCAGCGGGGGGGCTGGTGGCGTATGATCGGCACTTGATGGCGAAGCTTCAGGCGGCGAAGGCGGCGAAG
GAGCAGGCTGCTCAGGGGCAGGTGAATGATCAGGCACAAGGGAACCAAGGGCAAGGGCAGCAGAATGGGGAGGCT
CAGGGGAATCAAGGCCCAGGGCAGCAGGACCAAAAGGGACGAGGTCAACAAGATCAGGGAAGTCAACAGGGTCAA
CAGGCGGGAACACCAACTAGCAGCCAGCAGGGACAATCACCAGGAGCAGCCAGAGACCCAGGACAGCAAGGCCAG
GGTCAGCAGAACAAAAAGGGACGAGATCAGCAAGGTCAGGGAGGCCAACAGGGTCAACAAGCAGGAACACCAACT
GCCAACCAGCAAGGACAATCGCCAGGAGCAGCTAGAGAGCAGCAAGGTCAAGGTCAGCAGGGCCAGGGCCAGCAG
AACAAAAAAGGACGGGACCAGCAAAGTCAGGGAGGTCAACAAGGCCAACAAGCGGCATCAAATACTGGCAACCCG
CAAAGTCCGTCGGCGGGGGCAGCCAGAGGTCAGCAGCAGGGAGAGGGTCAAAGACAAGGCCAGCAGGGCCAGCAG
AGCCCTCAGGGGGCAACGCCGACTAGCAGCCAGCGAGATCAGGGGCAGCTTCAGGGGGGGAGTTCGGGTGCCCAG
CAAGCTGCGAGCTCGACTGTTGCTGGGGAGCAGCAGGGAAGGCCGACGGCGGCTGAGGAGGGACGACGGGGGCAG
CAGGGGCAGCAAGGTGAGCGAGGTCAAGCTGGACAGCCCGGACAGCCTGGGCAGCCTGGAGAGCCTGGGCAACCT
GGACAGCCCGGTCAGGCAGGACAGCCTGGACAACCTGGACAGCCCGGACAACCTGGGCAACCTGGGCAGCCTGCA
GAGCCTGGAAAGCCTGGAGAGCCTGGAAAGCCTGGAGAGCCTGGACAGGCAGGACAGGCAGGACAGGCAGGACAG
GCAGGACAGCCCGGTCAGGCAGGACAACCTGGACAGCCCGGACCGCCTGGTCAGCCTGGACAGCCTGGACAACCC
GGGCAGCCTGGGCAGCCTGGAGAGCCTGGACAACCCGGGCAGCCTGGACAGCCTGGACAACCCGGGCAGCCTGGG
CAGCCTGGAGAGCCTGGACAACCCGGGCAGCCTGGACAGCCTGGACAACCCGGACAGCCCGGACAGCCTGGTCAG
CCTGGACAGCCTGGTCCGCCTGGACAGGCAGGTCAGGCAGGTCAGGCAGGTCAGCCCGGACAGCCCGGACAACCT
GGACAACCCGGACAGGCAGGACAACCTGGACAGCCCGGACCGCCTGGTCAGCCTGGTCAGCCTGGACAACCCGGG
CAGCCTGGACAGGCAGGACAGGCAGGACAGGCAGGACAGGCAGGTCAGGCAGGTCAGGCAGGTCAGGCAGGTCAG
CCCGGACAACCTGGACAACCCGGACAGGCAGGGGAAGCAGGGCTGCCGGGGCAGTCAGGGCAACGAGGCCAGCAG
GGCTTGACAGGACAGCAGCAGGGCCAGCAAGGTCAACGAGGACAGCAGAGCCAGGGTCAACGTGGACATCAGAGT
CAGCAGGCGAAACATGGACAACGAGGACAGCAGAACCAGCCAGCGCAGCAGAGACAGCAAGGGACTCAGGGAACT
CAGGGGACTCAGGGGTCTCAGGGGTCTCAAGGATCACAAGGGGCACAAGGGGCACAAGGGGCACAAGGGGCACAA
GGGGCACAAGGGGCACAAGGCTCTCAGGGTTCTCAAGGCTCTCAAGGCTCTCAAGGCTCTCAAGGCTCTCAGGGG
TCTCAGGGCTCTCAAGGCTCTCAAGGCTCTCAAGGCTCTCAAGGTTCTCAAGGCTCCCAAGGCTCTCAAGGCTCT
CAGGGCTCTGGCGGCGGCCCTCAAGGCGGCGGCCCTCCCCCCCCCATCCAACTCCAACCCGGCGGCAGTCTCACA
GGCAACGTCCCCGGCCAACCCGGAGCCAGCCCGAACCGGCCCCCGGGCCCCCCCGGAACCCTCATCGGCGACCTC
GCCACCCTCCCAGACTCACAACTCACCCCCACAGGCGCCCAGATCAAGAAGATGCTCCTCAAAGACATCGACGGC
GACGACAACACGTCCTTCATGGCGCCCGTGCCCCCCCGGGACTCGGCGCAGTGCAGACAGGATACCTGCTGTATC
TGGAAGTACGTGGCCGAGGAGATGAGGGCGGCCATGACGCAGCAGGACGGCCAGTGCAATGATCTTGCTCGAGGT
TGTATCCGTCTCGGCTTCCATGATGCCATGGACTTTTCCAAGACGAACAACACCAATGCTGGAGCGGATGGATCC
ATCGTCCTGGCCGGAGAGTGCGAGACGGTAGCAGACAACAACGGACTCAAAAACACGTGCAACCAGATGAGAACC
TGGTTCGCAAAGTATTCCCCCTACGGCGTCGGAATGGCAGACCTCATCCAAATGGCGGCCAACGTCGGAACAGTC
GTCTGTCCCCTCGGCCCCCGAGTCCGGACCTTTGTCGGACGCCGAGACAGCACCGTCCGAGCCCCAGACGGAAAC
CTCCCTCTCTTCACCGACAGCAACGACCACATCCTCGCCCTCATGGACGACAAGACCATCTCCCCCTTTGGCCTC
ATCGCCCTGCTGGGCGCCCACTCCACGGCCCGTGCCCGCGACGCGAAGCCGGAGATTCCGGGGGATCATCGTCTG
GATTCGACGCCGGGGGTGTGGGATGTTGCGTTTTACGGTGAGGTTTTGGATAATGGTACGGCGACTGCGAATTTG
TTTAAGCTGGATAGTGATGTGAACCTCAGTCGGGATCAGAGGACGAGTGATTCTTGGAGGTTCTTTGTTGGGCAG
CAGCCGGGGCAATTCCGGTGGGACAAGGTGAGTCTTCCTCACTATGCTGCATTTTATCTCGCTGAAGACTAACGG
TTGGAAGGCTTACGCGGCTGAGTATATTCGCGTCAGCATGCTGGGCGTCAACAACATGAACAACCTGACCGAGTG
CACGGGGGTGCTGCCGCCGTTCATCCCCAACTTCGGGGGGATTACGACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail