Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2837
Gene name
LocationContig_252:3403..4958
Strand+
Gene length (bp)1555
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00698 Acyl_transf_1 Acyl transferase domain 2.6E-48 124 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 124 478 3.0E-50
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 119 468 3.0E-39
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 122 428 5.0E-36
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 122 428 3.0E-35
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 122 469 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 124 478 3.0E-50
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 119 468 3.0E-39
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 122 428 5.0E-36
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 122 428 3.0E-35
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 122 469 2.0E-33
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 122 419 7.0E-33
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 122 469 1.0E-32
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 125 428 2.0E-32
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 122 419 4.0E-32
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 122 469 1.0E-31
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 111 470 5.0E-31
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 123 454 1.0E-30
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 117 417 2.0E-30
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 111 470 8.0E-29
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 121 426 2.0E-28
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 122 425 9.0E-27
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 122 476 1.0E-26
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 122 431 2.0E-26
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 123 431 3.0E-26
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 123 470 3.0E-26
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 121 470 5.0E-26
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 121 470 2.0E-25
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 117 387 1.0E-24
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 39 470 1.0E-24
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 115 427 1.0E-24
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 39 466 3.0E-24
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 124 387 3.0E-24
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 39 470 4.0E-24
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 39 425 1.0E-23
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 39 425 1.0E-23
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 39 425 1.0E-23
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 39 425 1.0E-23
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 39 419 1.0E-23
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 124 449 2.0E-23
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 39 470 2.0E-23
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 124 449 2.0E-23
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 124 449 2.0E-23
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 121 470 5.0E-23
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 39 470 6.0E-23
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 121 466 7.0E-23
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 122 392 1.0E-22
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 39 470 1.0E-22
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 104 469 1.0E-22
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 121 466 3.0E-22
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 92 428 4.0E-22
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 121 466 4.0E-22
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 39 466 9.0E-22
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 121 470 9.0E-22
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 123 450 1.0E-21
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 123 469 4.0E-21
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 30 425 8.0E-21
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 124 327 1.0E-20
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 118 470 1.0E-20
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 35 425 2.0E-20
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 118 470 3.0E-20
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 122 385 5.0E-20
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 122 385 5.0E-20
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 122 385 5.0E-20
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 125 477 4.0E-19
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 125 477 5.0E-19
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 39 470 7.0E-19
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 34 470 1.0E-18
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 92 453 1.0E-18
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 123 461 2.0E-18
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 123 461 2.0E-18
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 123 461 2.0E-18
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 92 453 3.0E-18
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 37 425 4.0E-18
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 121 455 4.0E-18
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 122 390 4.0E-18
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 92 453 1.0E-17
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 92 453 1.0E-17
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 124 428 6.0E-17
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 92 453 1.0E-16
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 92 453 1.0E-16
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 39 453 3.0E-16
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 124 428 3.0E-16
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 37 416 6.0E-16
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 92 453 2.0E-15
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 92 453 3.0E-15
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 127 390 4.0E-15
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 124 428 4.0E-15
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 92 453 4.0E-15
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 30 426 6.0E-15
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 122 388 4.0E-14
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 122 388 2.0E-12
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 121 330 2.0E-12
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 123 387 4.0E-11
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 123 387 4.0E-11
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 124 335 5.0E-11
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 121 334 8.0E-11
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 121 334 3.0E-10
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 122 453 1.0E-09
sp|A0R0B2|FABD_MYCS2 Malonyl CoA-acyl carrier protein transacylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabD PE=1 SV=1 178 385 2.0E-06
sp|O13698|FABD_SCHPO Malonyl CoA-acyl carrier protein transacylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mct1 PE=3 SV=1 125 334 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1456
Ophiocordyceps camponoti-floridani Ophcf2|04509
Ophiocordyceps camponoti-floridani Ophcf2|05945
Ophiocordyceps camponoti-floridani Ophcf2|05210
Ophiocordyceps camponoti-floridani Ophcf2|04876
Ophiocordyceps camponoti-floridani Ophcf2|03559
Ophiocordyceps camponoti-floridani Ophcf2|02946
Ophiocordyceps camponoti-floridani Ophcf2|02940
Ophiocordyceps camponoti-floridani Ophcf2|02393
Ophiocordyceps camponoti-floridani Ophcf2|02162
Ophiocordyceps camponoti-floridani Ophcf2|01419
Ophiocordyceps camponoti-floridani Ophcf2|00877
Ophiocordyceps camponoti-floridani Ophcf2|00026
Ophiocordyceps camponoti-floridani Ophcf2|02640
Ophiocordyceps camponoti-rufipedis Ophun1|7018
Ophiocordyceps camponoti-rufipedis Ophun1|5875
Ophiocordyceps camponoti-rufipedis Ophun1|61
Ophiocordyceps camponoti-rufipedis Ophun1|7079
Ophiocordyceps camponoti-rufipedis Ophun1|2808
Ophiocordyceps camponoti-rufipedis Ophun1|7149
Ophiocordyceps camponoti-rufipedis Ophun1|7480
Ophiocordyceps camponoti-rufipedis Ophun1|5641
Ophiocordyceps camponoti-rufipedis Ophun1|7148
Ophiocordyceps camponoti-rufipedis Ophun1|5297
Ophiocordyceps camponoti-rufipedis Ophun1|839
Ophiocordyceps camponoti-rufipedis Ophun1|5181
Ophiocordyceps camponoti-rufipedis Ophun1|5180
Ophiocordyceps camponoti-rufipedis Ophun1|5123
Ophiocordyceps camponoti-rufipedis Ophun1|5085
Ophiocordyceps camponoti-rufipedis Ophun1|4013
Ophiocordyceps camponoti-rufipedis Ophun1|2837 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7483
Ophiocordyceps camponoti-rufipedis Ophun1|1461
Ophiocordyceps camponoti-rufipedis Ophun1|5183
Ophiocordyceps kimflemingae Ophio5|2713
Ophiocordyceps subramaniannii Hirsu2|2752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2837
MAVQYQPGLHQREARLRKEKSLGIDISRINAAAGPSSRLIPLSSPSPDGLKKVTATLETLLQQAKTQDSDSDSAI
LDRLVGKLMAEGIWTCWRSFALASSPAELLESQGLGQLVRVTDRHVVCFIFTGSGAQWFNMGRELLRFDVFRRSL
EASGRILEEMGCEWSLFDEMYFRDEPRIDEPGVFQPAVTALQIALADLVKSWNVRPGVVVGHSSGEIAAAFVKGA
ISRRSALKIAFVRGLVSHHISKPGGMLAVGLGEEAVKPVLEEVRQEGHYAVVGCTNSPRSVTVSGDDEALAASEA
ALNDKGVFHQRVRVSNAYHSGHVDEVADEYRDALTGLDGASDKVETDESDVVMFSSLTGKEVRASQLREPSYWVS
NLRDRVRFSEAVQGALRLARKETAAEKEDSTAVLMTELGPHPALRTPLRQTFQCHGQSYREKDSTQLVYGSLLAR
NRDAVRTTLETMGQYFQWGYVAPTTAVG*
Coding >Ophun1|2837
ATGGCCGTGCAGTATCAACCAGGACTCCACCAACGCGAGGCCCGCCTTAGAAAAGAAAAATCCCTCGGCATCGAC
ATCTCCCGCATCAACGCCGCAGCAGGCCCATCATCAAGACTCATCCCTCTCTCCTCCCCAAGCCCAGACGGCCTC
AAAAAGGTGACAGCCACGCTCGAAACCCTCCTCCAGCAAGCCAAGACCCAAGACTCCGACTCCGACTCGGCCATC
CTCGACCGCCTCGTCGGCAAGCTCATGGCAGAGGGCATCTGGACATGCTGGCGGTCCTTTGCCCTGGCGTCGAGC
CCGGCGGAGCTGCTGGAGAGTCAGGGGCTGGGACAGCTGGTGCGGGTCACGGACCGGCATGTCGTCTGCTTCATC
TTTACTGGCTCGGGGGCGCAGTGGTTCAACATGGGGCGGGAGCTTTTGCGCTTTGATGTTTTTAGGCGGAGTTTG
GAGGCTTCGGGGAGGATTCTTGAGGAGATGGGATGTGAATGGAGTCTTTTTGACGAGATGTACTTTCGGGATGAG
CCGAGGATTGACGAGCCCGGGGTGTTTCAGCCTGCTGTCACGGCGTTGCAGATTGCCTTGGCGGATTTGGTCAAG
AGTTGGAATGTGAGGCCTGGTGTTGTCGTTGGACATTCGAGCGGTGAGATTGCGGCTGCCTTTGTCAAAGGCGCC
ATCTCGCGGAGGAGCGCGCTCAAGATTGCCTTTGTGCGTGGCCTCGTCTCCCATCACATCTCGAAACCGGGCGGG
ATGCTGGCTGTTGGTCTCGGTGAAGAGGCCGTCAAGCCTGTTCTCGAAGAGGTTCGACAGGAAGGGCACTACGCT
GTCGTCGGCTGCACGAACAGCCCTCGGAGCGTCACTGTTTCTGGCGATGACGAGGCGCTGGCGGCCAGTGAGGCG
GCGTTGAATGACAAGGGCGTTTTTCATCAGAGGGTGCGGGTGAGTAACGCCTATCATAGCGGGCACGTGGATGAG
GTTGCGGATGAGTATCGTGATGCCTTGACGGGGCTGGACGGTGCGTCTGACAAGGTCGAGACCGATGAATCCGAC
GTGGTCATGTTCTCGTCCCTCACCGGCAAAGAGGTGCGAGCGTCACAGCTGAGAGAACCTTCCTACTGGGTCTCG
AACCTCCGGGATCGAGTCCGCTTCTCGGAAGCGGTACAGGGGGCTTTACGGCTTGCTCGGAAGGAGACTGCTGCG
GAAAAGGAGGACTCGACGGCCGTGCTGATGACGGAGCTGGGACCGCATCCGGCTTTGAGGACGCCGCTGCGACAG
ACGTTTCAGTGTCATGGCCAGAGCTACAGGGAGAAGGATTCTACGCAGCTTGTTTACGGGTCGTTGCTTGCGCGG
AATAGGGATGCTGTGAGGACGACGCTGGAGACGATGGGGCAGTACTTTCAGTGGGGGTATGTTGCGCCGACGACG
GCTGTGGGTTGA
Transcript >Ophun1|2837
ATGGCCGTGCAGTATCAACCAGGACTCCACCAACGCGAGGCCCGCCTTAGAAAAGAAAAATCCCTCGGCATCGAC
ATCTCCCGCATCAACGCCGCAGCAGGCCCATCATCAAGACTCATCCCTCTCTCCTCCCCAAGCCCAGACGGCCTC
AAAAAGGTGACAGCCACGCTCGAAACCCTCCTCCAGCAAGCCAAGACCCAAGACTCCGACTCCGACTCGGCCATC
CTCGACCGCCTCGTCGGCAAGCTCATGGCAGAGGGCATCTGGACATGCTGGCGGTCCTTTGCCCTGGCGTCGAGC
CCGGCGGAGCTGCTGGAGAGTCAGGGGCTGGGACAGCTGGTGCGGGTCACGGACCGGCATGTCGTCTGCTTCATC
TTTACTGGCTCGGGGGCGCAGTGGTTCAACATGGGGCGGGAGCTTTTGCGCTTTGATGTTTTTAGGCGGAGTTTG
GAGGCTTCGGGGAGGATTCTTGAGGAGATGGGATGTGAATGGAGTCTTTTTGACGAGATGTACTTTCGGGATGAG
CCGAGGATTGACGAGCCCGGGGTGTTTCAGCCTGCTGTCACGGCGTTGCAGATTGCCTTGGCGGATTTGGTCAAG
AGTTGGAATGTGAGGCCTGGTGTTGTCGTTGGACATTCGAGCGGTGAGATTGCGGCTGCCTTTGTCAAAGGCGCC
ATCTCGCGGAGGAGCGCGCTCAAGATTGCCTTTGTGCGTGGCCTCGTCTCCCATCACATCTCGAAACCGGGCGGG
ATGCTGGCTGTTGGTCTCGGTGAAGAGGCCGTCAAGCCTGTTCTCGAAGAGGTTCGACAGGAAGGGCACTACGCT
GTCGTCGGCTGCACGAACAGCCCTCGGAGCGTCACTGTTTCTGGCGATGACGAGGCGCTGGCGGCCAGTGAGGCG
GCGTTGAATGACAAGGGCGTTTTTCATCAGAGGGTGCGGGTGAGTAACGCCTATCATAGCGGGCACGTGGATGAG
GTTGCGGATGAGTATCGTGATGCCTTGACGGGGCTGGACGGTGCGTCTGACAAGGTCGAGACCGATGAATCCGAC
GTGGTCATGTTCTCGTCCCTCACCGGCAAAGAGGTGCGAGCGTCACAGCTGAGAGAACCTTCCTACTGGGTCTCG
AACCTCCGGGATCGAGTCCGCTTCTCGGAAGCGGTACAGGGGGCTTTACGGCTTGCTCGGAAGGAGACTGCTGCG
GAAAAGGAGGACTCGACGGCCGTGCTGATGACGGAGCTGGGACCGCATCCGGCTTTGAGGACGCCGCTGCGACAG
ACGTTTCAGTGTCATGGCCAGAGCTACAGGGAGAAGGATTCTACGCAGCTTGTTTACGGGTCGTTGCTTGCGCGG
AATAGGGATGCTGTGAGGACGACGCTGGAGACGATGGGGCAGTACTTTCAGTGGGGGTATGTTGCGCCGACGACG
GCTGTGGGTTGA
Gene >Ophun1|2837
ATGGCCGTGCAGTATCAACCAGGACTCCACCAACGCGAGGCCCGCCTTAGAAAAGAAAAATCCCTCGGCATCGAC
ATCTCCCGCATCAACGCCGCAGCAGGCCCATCATCAAGACTCATCCCTCTCTCCTCCCCAAGCCCAGACGGCCTC
AAAAAGGTGACAGCCACGCTCGAAACCCTCCTCCAGCAAGCCAAGACCCAAGACTCCGACTCCGACTCGGCCATC
CTCGACCGCCTCGTCGGCAAGCTCATGGCAGAGGGCATCTGGACATGCTGGCGGTCCTTTGCCCTGGCGTCGAGC
CCGGCGGAGCTGCTGGAGAGTCAGGGGCTGGGACAGCTGGTGCGGGTCACGGACCGGCATGTCGTCTGCTTCATC
TTTACTGGCTCGGGGGCGCAGTGGTTCAACATGGGGCGGGAGCTTTTGCGCTTTGATGTTTTTAGGCGGAGTTTG
GAGGCTTCGGGGAGGATTCTTGAGGAGATGGGATGTGAATGGAGTCTTTTTGGTGAGTTTTTTCTTCTTCCTTTC
TTCTGCGGTGCTTGACTGATGGTTATGTTATGAGTAGACGAGATGTACTTTCGGGATGAGCCGAGGATTGACGAG
CCCGGGGTGTTTCAGCCTGCTGTCACGGCGTTGCAGATTGCCTTGGCGGATTTGGTCAAGAGTTGGAATGTGAGG
CCTGGTGTTGTCGTTGGACATTCGAGCGGTGAGATTGCGGTGAGTTATGAGATGAGAAGAAGAGTTGTTGTTGCT
GTTGTTGCTAACTCTTCTACAGGCTGCCTTTGTCAAAGGCGCCATCTCGCGGAGGAGCGCGCTCAAGATTGCCTT
TGTGCGTGGCCTCGTCTCCCATCACATCTCGAAACCGGGCGGGATGCTGGCTGTTGGTCTCGGTGAAGAGGCCGT
CAAGCCTGTTCTCGAAGAGGTTCGACAGGAAGGGCACTACGCTGTCGTCGGCTGCACGAACAGCCCTCGGAGCGT
CACTGTTTCTGGCGATGACGAGGCGCTGGCGGCCAGTGAGGCGGCGTTGAATGACAAGGGCGTTTTTCATCAGAG
GGTGCGGGTGAGTAACGCCTATCATAGCGGGCACGTGGATGAGGTTGCGGATGAGTATCGTGATGCCTTGACGGG
GCTGGACGGTGCGTCTGACAAGGTCGAGACCGATGAATCCGACGTGGTCATGTTCTCGTCCCTCACCGGCAAAGA
GGTGCGAGCGTCACAGCTGAGAGAACCTTCCTACTGGGTCTCGAACCTCCGGGATCGAGTCCGCTTCTCGGAAGC
GGTACAGGGGGCTTTACGGCTTGCTCGGAAGGAGACTGCTGCGGAAAAGGAGGACTCGACGGCCGTGCTGATGAC
GGAGCTGGGACCGCATCCGGCTTTGAGGACGCCGCTGCGACAGACGTTTCAGTGTCATGGCCAGAGCTACAGGGA
GAAGGATTCTACGCAGCTTGTTTACGGGTCGTTGCTTGCGCGGAATAGGGATGCTGTGAGGACGACGCTGGAGAC
GATGGGGCAGTACTTTCAGTGGGGGTATGTTGCGCCGACGACGGCTGTGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail