Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2828
Gene name
LocationContig_251:7921..9329
Strand-
Gene length (bp)1408
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 1.7E-54 74 407

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XUC4|HKE41_CAEEL Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis elegans GN=hke-4.1 PE=2 SV=2 50 408 2.0E-48
sp|A8WMY3|HKE41_CAEBR Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis briggsae GN=hke-4.1 PE=3 SV=2 48 408 5.0E-47
sp|P40544|YKE4_YEAST Zinc transporter YKE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKE4 PE=1 SV=1 73 410 5.0E-46
sp|Q31125|S39A7_MOUSE Zinc transporter SLC39A7 OS=Mus musculus GN=Slc39a7 PE=1 SV=2 77 378 2.0E-44
sp|Q92504|S39A7_HUMAN Zinc transporter SLC39A7 OS=Homo sapiens GN=SLC39A7 PE=1 SV=2 77 378 5.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XUC4|HKE41_CAEEL Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis elegans GN=hke-4.1 PE=2 SV=2 50 408 2.0E-48
sp|A8WMY3|HKE41_CAEBR Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis briggsae GN=hke-4.1 PE=3 SV=2 48 408 5.0E-47
sp|P40544|YKE4_YEAST Zinc transporter YKE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKE4 PE=1 SV=1 73 410 5.0E-46
sp|Q31125|S39A7_MOUSE Zinc transporter SLC39A7 OS=Mus musculus GN=Slc39a7 PE=1 SV=2 77 378 2.0E-44
sp|Q92504|S39A7_HUMAN Zinc transporter SLC39A7 OS=Homo sapiens GN=SLC39A7 PE=1 SV=2 77 378 5.0E-42
sp|Q9XTQ7|HKE42_CAEEL Histidine-rich membrane protein KE4 homolog 2 OS=Caenorhabditis elegans GN=hke-4.2 PE=3 SV=2 70 410 1.0E-41
sp|Q5TJF6|S39A7_CANLF Zinc transporter SLC39A7 OS=Canis lupus familiaris GN=SLC39A7 PE=3 SV=1 77 378 3.0E-41
sp|Q9UT11|YLW3_SCHPO Uncharacterized zinc transporter P8A3.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.03 PE=3 SV=1 76 383 5.0E-41
sp|Q5RFD5|S39A7_PONAB Zinc transporter SLC39A7 OS=Pongo abelii GN=SLC39A7 PE=2 SV=1 77 378 1.0E-37
sp|Q5ZI20|S39AD_CHICK Zinc transporter ZIP13 OS=Gallus gallus GN=SLC39A13 PE=2 SV=1 104 378 1.0E-37
sp|Q9VAF0|S39AD_DROME Zinc transporter ZIP13 homolog OS=Drosophila melanogaster GN=Zip99C PE=2 SV=1 73 404 2.0E-37
sp|Q2M1K6|S39AD_RAT Zinc transporter ZIP13 OS=Rattus norvegicus GN=Slc39a13 PE=2 SV=1 104 378 7.0E-36
sp|Q8BZH0|S39AD_MOUSE Zinc transporter ZIP13 OS=Mus musculus GN=Slc39a13 PE=2 SV=1 104 408 2.0E-35
sp|Q9V3A4|CSUP_DROME Protein catecholamines up OS=Drosophila melanogaster GN=Catsup PE=2 SV=1 80 408 5.0E-35
sp|Q96H72|S39AD_HUMAN Zinc transporter ZIP13 OS=Homo sapiens GN=SLC39A13 PE=1 SV=3 104 408 9.0E-32
sp|Q8AW42|S39AD_DANRE Zinc transporter ZIP13 OS=Danio rerio GN=slc39a13 PE=2 SV=1 104 408 3.0E-31
sp|A8X482|HKE42_CAEBR Histidine-rich membrane protein KE4 homolog 2 OS=Caenorhabditis briggsae GN=hke-4.2 PE=3 SV=2 234 378 4.0E-31
sp|Q9PUB8|S39A7_DANRE Zinc transporter Slc39a7 (Fragment) OS=Danio rerio GN=slc39a7 PE=2 SV=1 75 291 5.0E-30
sp|A5D7H1|S39AD_BOVIN Zinc transporter ZIP13 OS=Bos taurus GN=SLC39A13 PE=2 SV=1 104 322 1.0E-25
sp|Q5R6I6|S39AD_PONAB Zinc transporter ZIP13 OS=Pongo abelii GN=SLC39A13 PE=2 SV=1 236 408 3.0E-25
sp|Q504Y0|S39AC_HUMAN Zinc transporter ZIP12 OS=Homo sapiens GN=SLC39A12 PE=2 SV=3 10 376 5.0E-24
sp|Q5FWH7|S39AC_MOUSE Zinc transporter ZIP12 OS=Mus musculus GN=Slc39a12 PE=1 SV=1 12 376 1.0E-23
sp|Q9M647|IAR1_ARATH IAA-alanine resistance protein 1 OS=Arabidopsis thaliana GN=IAR1 PE=1 SV=3 51 408 5.0E-21
sp|Q08E40|S39AC_BOVIN Zinc transporter ZIP12 OS=Bos taurus GN=SLC39A12 PE=2 SV=1 104 376 1.0E-19
sp|Q1KZG0|S39A4_BOVIN Zinc transporter ZIP4 OS=Bos taurus GN=SLC39A4 PE=1 SV=1 104 383 2.0E-19
sp|Q95KA5|S39AC_MACFA Zinc transporter ZIP12 OS=Macaca fascicularis GN=SLC39A12 PE=2 SV=1 10 376 2.0E-19
sp|Q6PEH9|S39AA_DANRE Zinc transporter ZIP10 OS=Danio rerio GN=slc39a10 PE=2 SV=1 226 408 5.0E-19
sp|Q6P5F6|S39AA_MOUSE Zinc transporter ZIP10 OS=Mus musculus GN=Slc39a10 PE=1 SV=1 240 408 7.0E-17
sp|A4IGY6|S39AE_XENTR Zinc transporter ZIP14 OS=Xenopus tropicalis GN=slc39a14 PE=2 SV=1 79 408 8.0E-17
sp|Q9ULF5|S39AA_HUMAN Zinc transporter ZIP10 OS=Homo sapiens GN=SLC39A10 PE=1 SV=2 240 408 1.0E-16
sp|Q9VSL7|FOI_DROME Zinc transporter foi OS=Drosophila melanogaster GN=foi PE=1 SV=3 240 410 6.0E-16
sp|A0JPN2|S39A4_RAT Zinc transporter ZIP4 OS=Rattus norvegicus GN=Slc39a4 PE=2 SV=1 79 383 2.0E-15
sp|Q4V887|S39A6_RAT Zinc transporter ZIP6 OS=Rattus norvegicus GN=Slc39a6 PE=1 SV=1 239 408 5.0E-15
sp|Q8C145|S39A6_MOUSE Zinc transporter ZIP6 OS=Mus musculus GN=Slc39a6 PE=1 SV=1 239 408 7.0E-15
sp|Q13433|S39A6_HUMAN Zinc transporter ZIP6 OS=Homo sapiens GN=SLC39A6 PE=1 SV=3 239 408 1.0E-14
sp|Q5R9M9|S39A6_PONAB Zinc transporter ZIP6 OS=Pongo abelii GN=SLC39A6 PE=2 SV=1 239 408 1.0E-14
sp|Q78IQ7|S39A4_MOUSE Zinc transporter ZIP4 OS=Mus musculus GN=Slc39a4 PE=1 SV=1 47 383 2.0E-14
sp|Q5FVQ0|S39A8_RAT Zinc transporter ZIP8 OS=Rattus norvegicus GN=Slc39a8 PE=2 SV=1 39 410 2.0E-14
sp|Q15043|S39AE_HUMAN Zinc transporter ZIP14 OS=Homo sapiens GN=SLC39A14 PE=1 SV=3 104 410 3.0E-14
sp|Q9D856|S39A5_MOUSE Zinc transporter ZIP5 OS=Mus musculus GN=Slc39a5 PE=1 SV=1 104 378 3.0E-14
sp|Q75N73|S39AE_MOUSE Zinc transporter ZIP14 OS=Mus musculus GN=Slc39a14 PE=1 SV=1 104 410 4.0E-14
sp|Q9C0K1|S39A8_HUMAN Zinc transporter ZIP8 OS=Homo sapiens GN=SLC39A8 PE=2 SV=1 39 410 4.0E-14
sp|Q5RAB7|S39AE_PONAB Zinc transporter ZIP14 OS=Pongo abelii GN=SLC39A14 PE=2 SV=2 104 408 9.0E-14
sp|Q91W10|S39A8_MOUSE Zinc transporter ZIP8 OS=Mus musculus GN=Slc39a8 PE=2 SV=1 101 410 2.0E-13
sp|A5D7L5|S39AE_BOVIN Zinc transporter ZIP14 OS=Bos taurus GN=SLC39A14 PE=2 SV=1 104 410 2.0E-13
sp|Q6P5W5|S39A4_HUMAN Zinc transporter ZIP4 OS=Homo sapiens GN=SLC39A4 PE=1 SV=3 104 382 2.0E-13
sp|Q6ZMH5|S39A5_HUMAN Zinc transporter ZIP5 OS=Homo sapiens GN=SLC39A5 PE=1 SV=3 209 294 4.0E-11
sp|Q29175|S39A7_PIG Zinc transporter SLC39A7 (Fragments) OS=Sus scrofa GN=SLC39A7 PE=2 SV=2 271 298 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0006810 transport No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999766

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 73 95 22
3 102 124 22
4 147 164 17
5 299 321 22
6 355 377 22
7 390 409 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5517
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6972
Ophiocordyceps australis map64 (Brazil) OphauB2|4214
Ophiocordyceps camponoti-floridani Ophcf2|04010
Ophiocordyceps camponoti-rufipedis Ophun1|2828 (this protein)
Ophiocordyceps kimflemingae Ophio5|8579
Ophiocordyceps subramaniannii Hirsu2|6789

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2828
MMRIQTQMLALAASLLVAIAAAHSSLTLSELDEKLQTCSVVQQLNAVKAQHHASHPPSSTARLFGMLFPSSRPAV
NALLATLYISGPPNFLLALCPTNIDPSSLSVMVAFAVGGLLGDTLFHLLPEIFLGEDDDERARLVLVEPNRNLLL
GLGILVGFMTFVAMDKGLRIATGGSGHDHGHGHGHGQAEPGHEVASSTTTGADAAAGQAKSRKKKGEREVRAAEP
TDKQAVNPSVKLGGYLNLIADFTHNITDGLAMSASFYASPTVGATTTMAVFFHEIPHEVGDFALLVQSGFSKRAA
MASQFVTAVGALLGTLIGIAVHEMGGNGGGGGGEGAAALPRDGGIWGTSLSWGDMLLPFTAGTFLYVGTVAVIPE
LLETGPRKMEELRKTMVQFAAVAVGAGVMLYISWH*
Coding >Ophun1|2828
ATGATGCGAATCCAGACGCAAATGCTGGCCCTCGCGGCGTCGCTGCTCGTCGCAATCGCAGCAGCCCACAGCAGC
CTGACCCTGAGCGAGCTAGACGAAAAGCTCCAGACGTGTTCTGTCGTCCAGCAGCTCAATGCAGTCAAGGCGCAG
CACCACGCGTCTCATCCACCCTCGTCGACGGCCCGTCTCTTCGGCATGCTGTTCCCCAGCTCGCGGCCGGCTGTC
AACGCGCTGTTGGCGACGCTGTACATCTCGGGACCGCCCAACTTCCTGCTGGCGCTGTGTCCGACGAATATCGAT
CCCTCGTCTTTGAGTGTCATGGTGGCTTTTGCTGTGGGTGGCTTGCTGGGTGATACGCTCTTTCATCTGCTGCCG
GAGATCTTTTTGGGTGAGGATGACGATGAGAGGGCGCGGTTGGTGCTCGTGGAGCCGAATCGCAATTTGCTGTTG
GGGCTTGGCATCTTGGTCGGCTTCATGACCTTTGTTGCTATGGATAAGGGGCTGCGCATCGCTACGGGAGGGTCG
GGACATGATCATGGTCATGGCCATGGACATGGCCAAGCTGAGCCGGGGCACGAGGTTGCATCATCGACGACGACG
GGCGCAGATGCCGCGGCGGGACAGGCCAAGTCGAGGAAGAAAAAGGGTGAGCGAGAGGTAAGGGCCGCTGAGCCG
ACGGACAAGCAGGCTGTCAATCCGAGTGTGAAGCTGGGCGGTTACCTCAACCTCATCGCCGACTTTACGCACAAC
ATCACCGACGGGTTGGCCATGTCTGCCAGCTTCTACGCGTCGCCGACGGTGGGCGCCACCACCACCATGGCCGTC
TTCTTCCACGAGATCCCGCACGAGGTGGGCGACTTTGCGCTGCTGGTGCAGTCGGGCTTCTCCAAGCGCGCGGCC
ATGGCGTCTCAGTTCGTAACGGCTGTCGGCGCCCTGCTGGGGACCCTGATTGGCATTGCCGTGCACGAGATGGGA
GGAAATGGTGGCGGCGGTGGCGGTGAGGGTGCTGCAGCCCTGCCACGCGACGGCGGGATTTGGGGGACGAGCCTC
AGCTGGGGGGATATGCTGCTGCCCTTTACGGCCGGCACCTTTTTGTACGTCGGCACCGTTGCCGTCATCCCCGAG
CTGTTGGAAACGGGGCCGAGGAAGATGGAGGAGCTTCGCAAGACGATGGTGCAGTTTGCCGCCGTGGCCGTGGGC
GCGGGAGTGATGCTGTACATTTCGTGGCATTAG
Transcript >Ophun1|2828
ATGATGCGAATCCAGACGCAAATGCTGGCCCTCGCGGCGTCGCTGCTCGTCGCAATCGCAGCAGCCCACAGCAGC
CTGACCCTGAGCGAGCTAGACGAAAAGCTCCAGACGTGTTCTGTCGTCCAGCAGCTCAATGCAGTCAAGGCGCAG
CACCACGCGTCTCATCCACCCTCGTCGACGGCCCGTCTCTTCGGCATGCTGTTCCCCAGCTCGCGGCCGGCTGTC
AACGCGCTGTTGGCGACGCTGTACATCTCGGGACCGCCCAACTTCCTGCTGGCGCTGTGTCCGACGAATATCGAT
CCCTCGTCTTTGAGTGTCATGGTGGCTTTTGCTGTGGGTGGCTTGCTGGGTGATACGCTCTTTCATCTGCTGCCG
GAGATCTTTTTGGGTGAGGATGACGATGAGAGGGCGCGGTTGGTGCTCGTGGAGCCGAATCGCAATTTGCTGTTG
GGGCTTGGCATCTTGGTCGGCTTCATGACCTTTGTTGCTATGGATAAGGGGCTGCGCATCGCTACGGGAGGGTCG
GGACATGATCATGGTCATGGCCATGGACATGGCCAAGCTGAGCCGGGGCACGAGGTTGCATCATCGACGACGACG
GGCGCAGATGCCGCGGCGGGACAGGCCAAGTCGAGGAAGAAAAAGGGTGAGCGAGAGGTAAGGGCCGCTGAGCCG
ACGGACAAGCAGGCTGTCAATCCGAGTGTGAAGCTGGGCGGTTACCTCAACCTCATCGCCGACTTTACGCACAAC
ATCACCGACGGGTTGGCCATGTCTGCCAGCTTCTACGCGTCGCCGACGGTGGGCGCCACCACCACCATGGCCGTC
TTCTTCCACGAGATCCCGCACGAGGTGGGCGACTTTGCGCTGCTGGTGCAGTCGGGCTTCTCCAAGCGCGCGGCC
ATGGCGTCTCAGTTCGTAACGGCTGTCGGCGCCCTGCTGGGGACCCTGATTGGCATTGCCGTGCACGAGATGGGA
GGAAATGGTGGCGGCGGTGGCGGTGAGGGTGCTGCAGCCCTGCCACGCGACGGCGGGATTTGGGGGACGAGCCTC
AGCTGGGGGGATATGCTGCTGCCCTTTACGGCCGGCACCTTTTTGTACGTCGGCACCGTTGCCGTCATCCCCGAG
CTGTTGGAAACGGGGCCGAGGAAGATGGAGGAGCTTCGCAAGACGATGGTGCAGTTTGCCGCCGTGGCCGTGGGC
GCGGGAGTGATGCTGTACATTTCGTGGCATTAG
Gene >Ophun1|2828
ATGATGCGAATCCAGACGCAAATGCTGGCCCTCGCGGCGTCGCTGCTCGTCGCAATCGCAGCAGCCCACAGCAGC
CTGACCCTGAGCGAGCTAGACGAAAAGCTCCAGGTTCGCGCCTCCGCACATCCATCTTCACAGGGACTAACGGGA
CCGTGATAGACGTGTTCTGTCGTCCAGCAGCTCAATGCAGTCAAGGCGCAGCACCACGCGTCTCATCCACCCTCG
TCGACGGCCCGTCTCTTCGGCATGCTGTTCCCCAGCTCGCGGCCGGCTGTCAACGCGCTGTTGGCGACGCTGTAC
ATCTCGGGACCGCCCAACTTCCTGCTGGCGCTGTGTCCGACGAATATCGATCCCTCGTCTTTGAGTGTCATGGTG
GCTTTTGCTGTGGGTGGCTTGCTGGGTGATACGCTCTTTCATCTGCTGCCGGAGATCTTTTTGGGTGAGGATGAC
GATGAGAGGGCGCGGTTGGTGCTCGTGGAGCCGAATCGCAATTTGCTGTTGGGGCTTGGCATCTTGGTCGGCTTC
ATGACCTTTGTTGCTATGGATAAGGGGCTGCGCATCGCTACGGGAGGGTCGGGACATGATCATGGTCATGGCCAT
GGACATGGCCAAGCTGAGCCGGGGCACGAGGTTGCATCATCGACGACGACGGGCGCAGATGCCGCGGCGGGACAG
GCCAAGTCGAGGAAGAAAAAGGGTGAGCGAGAGGTAAGGGCCGCTGAGCCGACGGACAAGCAGGCTGTCAATCCG
AGTGTGAAGCTGGGCGGTTACCTCAACCTCATGTACGTGCTCCCTCGTCGTATCCAGGGGCTGCCCGGGACTGAC
GCGGGTGCAGCGCCGACTTTACGCACAACATCACCGACGGGTTGGCCATGTCTGCCAGCTTCTACGCGTCGCCGA
CGGTGGGCGCCACCACCACCATGGCCGTCTTCTTCCACGAGATCCCGCACGAGGTGGGCGACTTTGCGCTGCTGG
TGCAGTCGGGCTTCTCCAAGCGCGCGGCCATGGCGTCTCAGTTCGTAACGGCTGTCGGCGCCCTGCTGGGGACCC
TGATTGGCATTGCCGTGCACGAGATGGGAGGAAATGGTGGCGGCGGTGGCGGTGAGGGTGCTGCAGCCCTGCCAC
GCGACGGCGGGATTTGGGGGACGAGCCTCGTGAGTTTTCCTTTTCTGGTGATGACGACGACGACGACGACGACGA
CCATGTCTGACGCTGTGGAACGCAGAGCTGGGGGGATATGCTGCTGCCCTTTACGGCCGGCACCTTTTTGTACGT
CGGCACCGTTGCCGTCATCCCCGAGCTGTTGGAAACGGGGCCGAGGAAGATGGAGGAGCTTCGCAAGACGATGGT
GCAGTTTGCCGCCGTGGCCGTGGGCGCGGGAGTGATGCTGTACATTTCGTGGCATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail