Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2826
Gene name
LocationContig_251:1614..4407
Strand-
Gene length (bp)2793
Transcript length (bp)2295
Coding sequence length (bp)2295
Protein length (aa) 765

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 7.9E-181 101 721

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 67 764 2.0E-129
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 69 764 3.0E-129
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 58 764 1.0E-123
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 58 764 1.0E-123
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 49 764 2.0E-123
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 67 764 2.0E-129
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 69 764 3.0E-129
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 58 764 1.0E-123
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 58 764 1.0E-123
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 49 764 2.0E-123
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 58 764 3.0E-123
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 58 764 1.0E-122
sp|A5D7E2|TM9S4_BOVIN Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2 58 764 3.0E-122
sp|Q55FP0|PHG1A_DICDI Putative phagocytic receptor 1a OS=Dictyostelium discoideum GN=phg1a PE=2 SV=1 70 764 3.0E-111
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 69 764 2.0E-105
sp|Q66HG5|TM9S2_RAT Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1 69 764 8.0E-105
sp|P58021|TM9S2_MOUSE Transmembrane 9 superfamily member 2 OS=Mus musculus GN=Tm9sf2 PE=1 SV=1 69 764 5.0E-104
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 69 764 5.0E-104
sp|F4JRE0|TMN12_ARATH Transmembrane 9 superfamily member 12 OS=Arabidopsis thaliana GN=TMN12 PE=2 SV=1 66 764 4.0E-96
sp|Q9FYQ8|TMN11_ARATH Transmembrane 9 superfamily member 11 OS=Arabidopsis thaliana GN=TMN11 PE=2 SV=1 69 764 6.0E-91
sp|P40071|TMN3_YEAST Transmembrane 9 superfamily member 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN3 PE=1 SV=1 66 758 1.0E-87
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 48 764 6.0E-85
sp|Q9Y819|YON8_SCHPO Transmembrane 9 superfamily protein C1105.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.08 PE=3 SV=1 76 764 1.0E-84
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 52 764 6.0E-84
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 447 764 1.0E-78
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 447 764 9.0E-77
sp|Q9FHT4|TMN4_ARATH Transmembrane 9 superfamily member 4 OS=Arabidopsis thaliana GN=TMN4 PE=2 SV=1 80 764 1.0E-75
sp|Q9ZPS7|TMN3_ARATH Transmembrane 9 superfamily member 3 OS=Arabidopsis thaliana GN=TMN3 PE=2 SV=1 80 764 4.0E-75
sp|Q54ZW0|PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum GN=phg1b PE=2 SV=1 80 764 7.0E-75
sp|Q940S0|TMN2_ARATH Transmembrane 9 superfamily member 2 OS=Arabidopsis thaliana GN=TMN2 PE=2 SV=1 80 764 7.0E-71
sp|Q9DBU0|TM9S1_MOUSE Transmembrane 9 superfamily member 1 OS=Mus musculus GN=Tm9sf1 PE=2 SV=2 77 764 2.0E-68
sp|Q5R8F1|TM9S1_PONAB Transmembrane 9 superfamily member 1 OS=Pongo abelii GN=TM9SF1 PE=2 SV=1 62 764 5.0E-68
sp|Q940G0|TMN1_ARATH Transmembrane 9 superfamily member 1 OS=Arabidopsis thaliana GN=TMN1 PE=1 SV=1 76 764 1.0E-66
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 62 764 1.0E-63
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 77 764 6.0E-63
sp|Q66HF2|TM9S1_RAT Transmembrane 9 superfamily member 1 OS=Rattus norvegicus GN=Tm9sf1 PE=2 SV=1 77 764 2.0E-59
sp|Q9HD45|TM9S3_HUMAN Transmembrane 9 superfamily member 3 OS=Homo sapiens GN=TM9SF3 PE=1 SV=2 79 764 2.0E-51
sp|Q9ET30|TM9S3_MOUSE Transmembrane 9 superfamily member 3 OS=Mus musculus GN=Tm9sf3 PE=1 SV=1 79 764 3.0E-51
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 290 764 8.0E-47
sp|Q7YTA6|PHG1C_DICDI Putative phagocytic receptor 1c OS=Dictyostelium discoideum GN=phg1c PE=2 SV=1 225 764 6.0E-43
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 68 376 2.0E-34
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 68 376 1.0E-33
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 76 191 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 349 371 22
2 468 490 22
3 500 522 22
4 535 557 22
5 567 589 22
6 622 644 22
7 654 676 22
8 689 711 22
9 726 748 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2826
MMGNDVDVATRIGELFDNDSIDHVFESQPQHLIGLGSAATVEPDRASLVTIMVRASRLLPLWLPCLVEGFYIPGW
SIKSYRSGDSVPLFVNKVYSDNTQLQYAYYDLPFVCPPTGHAGAKAGLFSGQSVPLNLGEVLRGDRIKASDMEIV
MGRDTACTFLCTRRLPRADLERTRDMVRDGYLTEWIVDNLPGATSFVTTDKTKKYYAAGFKLGYTETAPVTGELR
YFLHNHHTIVIRHRKAPGRAGERGERVVVGFEVYPKSVGSENKRDASGCPVDLKNVKGGLELRISDKKMAVRSPE
EDAKKEEEDDSLAIPYTYSVYFREDESIEWARRWDLYFVNQEEGSRIHWLALVNSLIICGLLSGIVMLILVRKTA
RREAVEEDGKIRMRKMGPRRRRRRDKNASGLLSGPGAEDGGVSDDDDGDDVGDDGGDVDSDEDDEAMEDATGWKL
LHADVFRKPPMVKLLAPLVGSGMQLLFVAAGLVLLSAVGILNPSFRGGFISVGVGLFISGGLVSGYLSARVYRSL
EGVDDAGNGLTTALLFPGLALCSALVLNTFAWAQASSTAMPIGTLLAMVVLWLCVQVPLVLIGSRLGRGRGWEHP
SRTAPIARQVPAQAWYARPIQSTLLAGLMPFIVIFIELLFVFQSVWQDKSGYYYVFGFLAAASTIQMVTVAEVTV
VTVYMQLCAEDHRWWWRSFCAGAGSAVWVFGYCVWCYAFKLHVAGFVSGLLFFAYSFMACVAYGLLAGAVGFLSA
YAFVRRMYGSIKVD*
Coding >Ophun1|2826
ATGATGGGTAACGACGTCGACGTTGCCACGAGGATAGGAGAACTCTTCGACAACGACTCCATCGACCACGTCTTC
GAATCCCAGCCCCAGCATCTCATTGGCCTCGGCTCGGCTGCGACGGTCGAGCCGGACCGAGCCTCCCTTGTCACC
ATCATGGTTCGAGCGTCGCGACTCTTGCCTCTATGGCTGCCCTGTCTCGTCGAGGGCTTCTACATACCCGGCTGG
TCCATCAAGTCCTACCGTTCGGGCGACTCGGTTCCCCTGTTCGTCAACAAGGTCTACTCAGACAACACGCAGCTG
CAATACGCATACTACGACCTCCCCTTCGTGTGTCCTCCCACAGGCCATGCCGGCGCCAAGGCAGGCCTATTTAGC
GGGCAGAGCGTGCCGCTGAATCTGGGCGAGGTGCTGCGCGGCGACCGCATCAAGGCTTCTGACATGGAGATTGTC
ATGGGTCGGGATACGGCTTGCACCTTTCTCTGCACGAGGAGGTTGCCGCGCGCGGACCTGGAGCGGACTCGCGAT
ATGGTGCGCGACGGCTATCTGACGGAATGGATCGTTGATAACTTGCCCGGCGCGACGAGCTTTGTGACGACGGAC
AAGACGAAGAAGTATTATGCTGCTGGGTTCAAGCTGGGGTACACGGAGACGGCGCCGGTGACGGGCGAGCTTCGG
TATTTCTTACACAATCATCATACCATTGTCATTCGACATCGGAAGGCGCCTGGACGTGCTGGTGAGAGGGGGGAG
CGTGTCGTCGTGGGCTTCGAGGTCTACCCCAAGAGCGTTGGGAGTGAGAATAAGAGGGATGCGTCGGGGTGTCCT
GTTGATTTGAAGAATGTCAAGGGGGGGCTTGAGCTTCGAATATCGGACAAGAAGATGGCTGTTCGGTCGCCCGAG
GAGGATGCGAAGAAAGAGGAGGAGGACGACTCGCTTGCGATTCCCTACACGTACTCGGTCTACTTTCGCGAGGAT
GAGAGCATTGAATGGGCGCGTCGCTGGGATCTCTATTTTGTCAACCAGGAAGAGGGCTCGCGCATCCACTGGCTG
GCATTGGTCAACTCGCTCATCATCTGCGGTCTACTCAGCGGCATCGTCATGCTGATACTTGTGAGGAAGACGGCG
CGCAGGGAGGCCGTGGAGGAGGATGGAAAGATTCGGATGCGAAAGATGGGACCGCGAAGGAGGAGGAGACGTGAC
AAGAACGCTTCGGGGCTGCTCTCCGGACCAGGGGCGGAAGACGGCGGCGTGTCGGATGATGACGACGGAGACGAT
GTTGGCGATGACGGCGGTGATGTTGACAGCGACGAGGATGACGAGGCGATGGAGGACGCTACGGGCTGGAAACTG
CTGCACGCCGACGTCTTCCGCAAGCCACCCATGGTCAAGCTCCTCGCTCCACTGGTAGGCTCAGGCATGCAACTC
CTCTTCGTGGCAGCAGGCCTGGTGCTACTCAGCGCAGTCGGGATCCTGAACCCCAGTTTCCGCGGCGGCTTCATC
AGCGTCGGCGTCGGCCTCTTCATCTCGGGCGGTCTGGTATCGGGATACCTCTCGGCACGGGTATACCGGAGTCTG
GAAGGCGTGGACGATGCGGGCAACGGGCTTACGACGGCGTTGCTGTTTCCGGGGCTGGCCTTGTGTTCCGCGCTG
GTGCTCAATACCTTTGCTTGGGCGCAGGCTTCGAGTACGGCTATGCCTATAGGGACGCTGTTGGCTATGGTGGTT
CTCTGGCTTTGCGTCCAGGTTCCTCTCGTTCTGATCGGGTCTCGACTTGGACGGGGCCGTGGATGGGAGCACCCT
TCTCGGACTGCGCCCATCGCTCGTCAGGTGCCGGCACAAGCCTGGTATGCACGCCCGATACAATCGACGCTGCTG
GCGGGCCTGATGCCCTTTATCGTCATCTTCATCGAGCTCCTCTTCGTCTTCCAATCCGTGTGGCAGGATAAGAGC
GGCTACTACTACGTCTTCGGCTTCCTGGCCGCGGCATCGACGATACAGATGGTGACGGTGGCCGAGGTAACGGTG
GTGACGGTCTACATGCAACTCTGCGCCGAGGATCACCGCTGGTGGTGGCGGTCGTTTTGCGCAGGGGCTGGCAGT
GCGGTGTGGGTGTTTGGCTACTGCGTTTGGTGCTATGCGTTTAAGCTGCATGTTGCGGGTTTCGTGAGCGGGTTG
CTGTTCTTTGCGTATAGCTTCATGGCTTGCGTTGCCTATGGGCTTCTTGCTGGGGCGGTGGGATTCCTGAGCGCT
TATGCGTTTGTGAGGCGCATGTACGGGTCTATCAAGGTGGATTGA
Transcript >Ophun1|2826
ATGATGGGTAACGACGTCGACGTTGCCACGAGGATAGGAGAACTCTTCGACAACGACTCCATCGACCACGTCTTC
GAATCCCAGCCCCAGCATCTCATTGGCCTCGGCTCGGCTGCGACGGTCGAGCCGGACCGAGCCTCCCTTGTCACC
ATCATGGTTCGAGCGTCGCGACTCTTGCCTCTATGGCTGCCCTGTCTCGTCGAGGGCTTCTACATACCCGGCTGG
TCCATCAAGTCCTACCGTTCGGGCGACTCGGTTCCCCTGTTCGTCAACAAGGTCTACTCAGACAACACGCAGCTG
CAATACGCATACTACGACCTCCCCTTCGTGTGTCCTCCCACAGGCCATGCCGGCGCCAAGGCAGGCCTATTTAGC
GGGCAGAGCGTGCCGCTGAATCTGGGCGAGGTGCTGCGCGGCGACCGCATCAAGGCTTCTGACATGGAGATTGTC
ATGGGTCGGGATACGGCTTGCACCTTTCTCTGCACGAGGAGGTTGCCGCGCGCGGACCTGGAGCGGACTCGCGAT
ATGGTGCGCGACGGCTATCTGACGGAATGGATCGTTGATAACTTGCCCGGCGCGACGAGCTTTGTGACGACGGAC
AAGACGAAGAAGTATTATGCTGCTGGGTTCAAGCTGGGGTACACGGAGACGGCGCCGGTGACGGGCGAGCTTCGG
TATTTCTTACACAATCATCATACCATTGTCATTCGACATCGGAAGGCGCCTGGACGTGCTGGTGAGAGGGGGGAG
CGTGTCGTCGTGGGCTTCGAGGTCTACCCCAAGAGCGTTGGGAGTGAGAATAAGAGGGATGCGTCGGGGTGTCCT
GTTGATTTGAAGAATGTCAAGGGGGGGCTTGAGCTTCGAATATCGGACAAGAAGATGGCTGTTCGGTCGCCCGAG
GAGGATGCGAAGAAAGAGGAGGAGGACGACTCGCTTGCGATTCCCTACACGTACTCGGTCTACTTTCGCGAGGAT
GAGAGCATTGAATGGGCGCGTCGCTGGGATCTCTATTTTGTCAACCAGGAAGAGGGCTCGCGCATCCACTGGCTG
GCATTGGTCAACTCGCTCATCATCTGCGGTCTACTCAGCGGCATCGTCATGCTGATACTTGTGAGGAAGACGGCG
CGCAGGGAGGCCGTGGAGGAGGATGGAAAGATTCGGATGCGAAAGATGGGACCGCGAAGGAGGAGGAGACGTGAC
AAGAACGCTTCGGGGCTGCTCTCCGGACCAGGGGCGGAAGACGGCGGCGTGTCGGATGATGACGACGGAGACGAT
GTTGGCGATGACGGCGGTGATGTTGACAGCGACGAGGATGACGAGGCGATGGAGGACGCTACGGGCTGGAAACTG
CTGCACGCCGACGTCTTCCGCAAGCCACCCATGGTCAAGCTCCTCGCTCCACTGGTAGGCTCAGGCATGCAACTC
CTCTTCGTGGCAGCAGGCCTGGTGCTACTCAGCGCAGTCGGGATCCTGAACCCCAGTTTCCGCGGCGGCTTCATC
AGCGTCGGCGTCGGCCTCTTCATCTCGGGCGGTCTGGTATCGGGATACCTCTCGGCACGGGTATACCGGAGTCTG
GAAGGCGTGGACGATGCGGGCAACGGGCTTACGACGGCGTTGCTGTTTCCGGGGCTGGCCTTGTGTTCCGCGCTG
GTGCTCAATACCTTTGCTTGGGCGCAGGCTTCGAGTACGGCTATGCCTATAGGGACGCTGTTGGCTATGGTGGTT
CTCTGGCTTTGCGTCCAGGTTCCTCTCGTTCTGATCGGGTCTCGACTTGGACGGGGCCGTGGATGGGAGCACCCT
TCTCGGACTGCGCCCATCGCTCGTCAGGTGCCGGCACAAGCCTGGTATGCACGCCCGATACAATCGACGCTGCTG
GCGGGCCTGATGCCCTTTATCGTCATCTTCATCGAGCTCCTCTTCGTCTTCCAATCCGTGTGGCAGGATAAGAGC
GGCTACTACTACGTCTTCGGCTTCCTGGCCGCGGCATCGACGATACAGATGGTGACGGTGGCCGAGGTAACGGTG
GTGACGGTCTACATGCAACTCTGCGCCGAGGATCACCGCTGGTGGTGGCGGTCGTTTTGCGCAGGGGCTGGCAGT
GCGGTGTGGGTGTTTGGCTACTGCGTTTGGTGCTATGCGTTTAAGCTGCATGTTGCGGGTTTCGTGAGCGGGTTG
CTGTTCTTTGCGTATAGCTTCATGGCTTGCGTTGCCTATGGGCTTCTTGCTGGGGCGGTGGGATTCCTGAGCGCT
TATGCGTTTGTGAGGCGCATGTACGGGTCTATCAAGGTGGATTGA
Gene >Ophun1|2826
ATGATGGGTAACGACGTCGACGTTGCCACGAGTGATTGTACCTAATACTACATGCCTCTTTGCCCGGATGAAGCG
TCGACCGCCCGGATCCGAGCCTTGCATTCGTATGCCCTGTGCCTTGTATTCGTGAGTGATTAGTTGTGGTGATGT
TAAGGGAGGGTTGAGGTTGGGATGAGGTCGAAAGGAGGCGTGCATGTTGGAAGGCTGTGGTATGGAGAACCTGGC
GGAAGAGAGGATATAAGTACACAGTGTTGATCCAATTAAGTATGAAACCAACTTTGCCGAATCTCGCCGTCTGTA
CAGTGCGATTAGATATTCTTACTGCCAGCTCCTTCCTGAATACCCGGAGGAAAGTACCTGAGACTTTTCTTGACA
CATGCTCTCGCAGCCAATCCTCGTCAACCGCTTTCATCTCCAGGGATAGGAGAACTCTTCGACAACGACTCCATC
GACCACGTCTTCGAATCCCAGCCCCAGCATCTCATTGGCCTCGGCTCGGCTGCGACGGTCGAGCCGGACCGAGCC
TCCCTTGTCACCATCATGGTTCGAGCGTCGCGACTCTTGCCTCTATGGCTGCCCTGTCTCGTCGAGGGCTTCTAC
ATACCCGGTTCGCTACCACAGCGCAGACAGGACCATGACGATGGCTGACGATCGTAGGCTGGTCCATCAAGTCCT
ACCGTTCGGGCGACTCGGTTCCCCTGTTCGTCAACAAGGTCTACTCAGACAACACGCAGCTGCAATACGCATACT
ACGACCTCCCCTTCGTGTGTCCTCCCACAGGCCATGCCGGCGCCAAGGCAGGCCTATTTAGCGGGCAGAGCGTGC
CGCTGAATCTGGGCGAGGTGCTGCGCGGCGACCGCATCAAGGCTTCTGACATGGAGATTGTCATGGGTCGGGATA
CGGCTTGCACCTTTCTCTGCACGAGGAGGTTGCCGCGCGCGGACCTGGAGCGGACTCGCGATATGGTGCGCGACG
GCTATCTGACGGAATGGATCGTTGATAACTTGCCCGGCGCGACGAGCTTTGTGACGACGGACAAGACGAAGAAGT
ATTATGCTGCTGGGTTCAAGCTGGGGTACACGGAGACGGCGCCGGTGACGGGCGAGCTTCGGTATTTCTTACACA
ATCATCATACCATTGTCATTCGACATCGGAAGGCGCCTGGACGTGCTGGTGAGAGGGGGGAGCGTGTCGTCGTGG
GCTTCGAGGTCTACCCCAAGAGCGTTGGGAGTGAGAATAAGAGGGATGCGTCGGGGTGTCCTGTTGATTTGAAGA
ATGTCAAGGGGGGGCTTGAGCTTCGAATATCGGACAAGAAGATGGCTGTTCGGTCGCCCGAGGAGGATGCGAAGA
AAGAGGAGGAGGACGACTCGCTTGCGATTCCCTACACGTACTCGGTCTACTTTCGCGAGGATGAGAGCATTGAAT
GGGCGCGTCGCTGGGATCTCTATTTTGTCAACCAGGAAGAGGGCTCGCGCATCCACTGGCTGGCATTGGTCAACT
CGCTCATCATCTGCGGTCTACTCAGCGGCATCGTCATGCTGATACTTGTGAGGAAGACGGCGCGCAGGGAGGCCG
TGGAGGAGGATGGAAAGATTCGGATGCGAAAGATGGGACCGCGAAGGAGGAGGAGACGTGACAAGAACGCTTCGG
GGCTGCTCTCCGGACCAGGGGCGGAAGACGGCGGCGTGTCGGATGATGACGACGGAGACGATGTTGGCGATGACG
GCGGTGATGTTGACAGCGACGAGGATGACGAGGCGATGGAGGACGCTACGGGCTGGAAACTGCTGCACGCCGACG
TCTTCCGCAAGCCACCCATGGTCAAGCTCCTCGCTCCACTGGTAGGCTCAGGCATGCAACTCCTCTTCGTGGCAG
CAGGCCTGGTGCTACTCAGCGCAGTCGGGATCCTGAACCCCAGTTTCCGCGGCGGCTTCATCAGCGTCGGCGTCG
GCCTCTTCATCTCGGGCGGTCTGGTATCGGGATACCTCTCGGCACGGGTATACCGGAGTCTGGAAGGCGTGGACG
ATGCGGGCAACGGGCTTACGACGGCGTTGCTGTTTCCGGGGCTGGCCTTGTGTTCCGCGCTGGTGCTCAATACCT
TTGCTTGGGCGCAGGCTTCGAGTACGGCTATGCCTATAGGGACGCTGTTGGCTATGGTGGTTCTCTGGCTTTGCG
TCCAGGTTCCTCTCGTTCTGATCGGGTCTCGACTTGGACGGGGCCGTGGATGGGAGCACCCTTCTCGGACTGCGC
CCATCGCTCGTCAGGTGCCGGCACAAGCCTGGTATGCACGCCCGATACAATCGACGCTGCTGGCGGGCCTGATGC
CCTTTATCGTCATCTTCATCGAGCTCCTCTTCGTCTTCCAATCCGTGTGGCAGGATAAGAGCGGCTACTACTACG
TCTTCGGCTTCCTGGCCGCGGCATCGACGATACAGATGGTGACGGTGGCCGAGGTAACGGTGGTGACGGTCTACA
TGCAACTCTGCGCCGAGGATCACCGCTGGTGGTGGCGGTCGTTTTGCGCAGGGGCTGGCAGTGCGGTGTGGGTGT
TTGGCTACTGCGTTTGGTGCTATGCGTTTAAGCTGCATGTTGCGGGTTTCGTGAGCGGGTTGCTGTTCTTTGCGT
ATAGCTTCATGGCTTGCGTTGCCTATGGGCTTCTTGCTGGGGCGGTGGGATTCCTGAGCGCTTATGCGTTTGTGA
GGCGCATGTACGGGTGAGTATCTGGTTGGGTCTGGTGTTGCTGAGGTTGCTTTTGCTGACGGATGTGCGGATAGG
TCTATCAAGGTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail