Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2813
Gene name
LocationContig_25:61063..62296
Strand+
Gene length (bp)1233
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 6.2E-25 74 369
PF07969 Amidohydro_3 Amidohydrolase family 2.4E-07 263 369

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8R9L4|MTAD_CALS4 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mtaD PE=3 SV=1 25 402 2.0E-06
sp|B0K2W0|MTAD_THEPX 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermoanaerobacter sp. (strain X514) GN=mtaD PE=3 SV=1 25 392 5.0E-06
sp|B0K8R8|MTAD_THEP3 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mtaD PE=3 SV=1 25 392 5.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.99975

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup811
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5089
Ophiocordyceps australis map64 (Brazil) OphauB2|144
Ophiocordyceps australis map64 (Brazil) OphauB2|2380
Ophiocordyceps camponoti-floridani Ophcf2|00020
Ophiocordyceps camponoti-rufipedis Ophun1|2813 (this protein)
Ophiocordyceps kimflemingae Ophio5|4078
Ophiocordyceps subramaniannii Hirsu2|3739
Ophiocordyceps subramaniannii Hirsu2|6049

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2813
MQTSIIYSALLLLWSHATRAHTFTIKDVTIVDVKTGGLLPQKNIVVEDNKILSIDDAKNSTTLQDGDIDGQGKFA
IPGPSDMHVHVFFSNNPASFEIGNNITMPLFVANGVTTIRDLGSNLIAIKSARDNVEQHKLVGPRVFFTGPMLDG
IDSPFETTIRLTTPEEAQREVKNLKDSGVDYIKVHLKLSRSVFDEVARACKDENITFGGHVPDSITPQHAVEMGM
GFIEHMSRLDDIDSELQKTIQDKQIWQCPTLKLGPAPQRFELTKTLFDAKVPMVAGTDSPAGQNLCPGFSLLDEL
ELMNEAGLSQLETLQTATVNAASSLGSKGLLMGTIEVGKLADIVLLDKNPLEDISNVRNISTVIADGQVFSKNEI
EKMLTGADRLSQCVEQRGTIAARDLVSAGPSCCSV*
Coding >Ophun1|2813
ATGCAGACAAGCATAATTTACTCAGCTTTATTGCTATTGTGGTCACATGCGACTCGGGCACACACTTTTACCATT
AAAGACGTCACCATCGTCGATGTCAAGACTGGGGGCCTGTTGCCCCAAAAGAACATTGTCGTCGAGGACAACAAA
ATCCTGAGTATCGACGATGCAAAGAACTCCACGACACTTCAAGATGGCGATATCGACGGCCAAGGCAAGTTTGCC
ATTCCAGGTCCCAGCGACATGCACGTCCACGTCTTCTTCAGCAACAATCCCGCTTCTTTTGAAATTGGAAACAAC
ATCACCATGCCGCTCTTCGTCGCCAACGGCGTGACGACCATTCGCGATCTTGGCAGTAATCTGATAGCCATCAAG
TCCGCACGTGATAACGTCGAACAGCACAAGCTCGTTGGGCCGCGCGTCTTCTTCACAGGCCCTATGCTAGACGGC
ATAGACTCACCGTTTGAAACGACCATAAGACTCACGACCCCGGAAGAGGCGCAACGGGAGGTCAAGAACCTCAAG
GACAGCGGCGTCGACTATATCAAGGTGCACCTAAAGCTCTCCCGATCAGTCTTCGACGAGGTGGCGCGAGCATGT
AAAGACGAGAACATCACTTTTGGCGGCCATGTCCCAGACTCCATCACCCCCCAGCACGCAGTCGAGATGGGCATG
GGCTTTATCGAGCACATGAGCCGCCTCGACGACATCGACAGCGAGCTGCAGAAGACGATCCAGGACAAGCAAATT
TGGCAGTGCCCTACACTGAAGCTTGGACCAGCTCCCCAACGTTTCGAGCTCACCAAGACTCTATTCGACGCCAAG
GTCCCAATGGTCGCCGGCACAGACTCTCCAGCTGGTCAGAATCTGTGTCCCGGCTTCAGTCTCCTCGACGAGCTC
GAGCTGATGAATGAAGCTGGTCTTAGCCAGCTGGAGACGTTGCAGACGGCCACGGTTAACGCTGCCTCCTCACTG
GGGTCCAAAGGGTTGCTGATGGGAACTATCGAAGTTGGAAAGCTGGCGGATATTGTCTTGCTAGACAAGAACCCC
CTTGAAGATATTAGCAACGTGCGCAACATCAGTACCGTCATCGCTGATGGACAAGTCTTTTCGAAAAACGAAATT
GAGAAGATGCTTACGGGGGCGGATCGACTCAGCCAATGTGTTGAACAGCGTGGCACCATAGCTGCGAGAGATCTG
GTAAGTGCTGGTCCGTCATGTTGTTCCGTGTAG
Transcript >Ophun1|2813
ATGCAGACAAGCATAATTTACTCAGCTTTATTGCTATTGTGGTCACATGCGACTCGGGCACACACTTTTACCATT
AAAGACGTCACCATCGTCGATGTCAAGACTGGGGGCCTGTTGCCCCAAAAGAACATTGTCGTCGAGGACAACAAA
ATCCTGAGTATCGACGATGCAAAGAACTCCACGACACTTCAAGATGGCGATATCGACGGCCAAGGCAAGTTTGCC
ATTCCAGGTCCCAGCGACATGCACGTCCACGTCTTCTTCAGCAACAATCCCGCTTCTTTTGAAATTGGAAACAAC
ATCACCATGCCGCTCTTCGTCGCCAACGGCGTGACGACCATTCGCGATCTTGGCAGTAATCTGATAGCCATCAAG
TCCGCACGTGATAACGTCGAACAGCACAAGCTCGTTGGGCCGCGCGTCTTCTTCACAGGCCCTATGCTAGACGGC
ATAGACTCACCGTTTGAAACGACCATAAGACTCACGACCCCGGAAGAGGCGCAACGGGAGGTCAAGAACCTCAAG
GACAGCGGCGTCGACTATATCAAGGTGCACCTAAAGCTCTCCCGATCAGTCTTCGACGAGGTGGCGCGAGCATGT
AAAGACGAGAACATCACTTTTGGCGGCCATGTCCCAGACTCCATCACCCCCCAGCACGCAGTCGAGATGGGCATG
GGCTTTATCGAGCACATGAGCCGCCTCGACGACATCGACAGCGAGCTGCAGAAGACGATCCAGGACAAGCAAATT
TGGCAGTGCCCTACACTGAAGCTTGGACCAGCTCCCCAACGTTTCGAGCTCACCAAGACTCTATTCGACGCCAAG
GTCCCAATGGTCGCCGGCACAGACTCTCCAGCTGGTCAGAATCTGTGTCCCGGCTTCAGTCTCCTCGACGAGCTC
GAGCTGATGAATGAAGCTGGTCTTAGCCAGCTGGAGACGTTGCAGACGGCCACGGTTAACGCTGCCTCCTCACTG
GGGTCCAAAGGGTTGCTGATGGGAACTATCGAAGTTGGAAAGCTGGCGGATATTGTCTTGCTAGACAAGAACCCC
CTTGAAGATATTAGCAACGTGCGCAACATCAGTACCGTCATCGCTGATGGACAAGTCTTTTCGAAAAACGAAATT
GAGAAGATGCTTACGGGGGCGGATCGACTCAGCCAATGTGTTGAACAGCGTGGCACCATAGCTGCGAGAGATCTG
GTAAGTGCTGGTCCGTCATGTTGTTCCGTGTAG
Gene >Ophun1|2813
ATGCAGACAAGCATAATTTACTCAGCTTTATTGCTATTGTGGTCACATGCGACTCGGGCACACACTTTTACCATT
AAAGACGTCACCATCGTCGATGTCAAGACTGGGGGCCTGTTGCCCCAAAAGAACATTGTCGTCGAGGACAACAAA
ATCCTGAGTATCGACGATGCAAAGAACTCCACGACACTTCAAGATGGCGATATCGACGGCCAAGGCAAGTTTGCC
ATTCCAGGTCCCAGCGACATGCACGTCCACGTCTTCTTCAGCAACAATCCCGCTTCTTTTGAAATTGGAAACAAC
ATCACCATGCCGCTCTTCGTCGCCAACGGCGTGACGACCATTCGCGATCTTGGCAGTAATCTGATAGCCATCAAG
TCCGCACGTGATAACGTCGAACAGCACAAGCTCGTTGGGCCGCGCGTCTTCTTCACAGGCCCTATGCTAGACGGC
ATAGACTCACCGTTTGAAACGACCATAAGACTCACGACCCCGGAAGAGGCGCAACGGGAGGTCAAGAACCTCAAG
GACAGCGGCGTCGACTATATCAAGGTGCACCTAAAGCTCTCCCGATCAGTCTTCGACGAGGTGGCGCGAGCATGT
AAAGACGAGAACATCACTTTTGGCGGCCATGTCCCAGACTCCATCACCCCCCAGCACGCAGTCGAGATGGGCATG
GGCTTTATCGAGCACATGAGCCGCCTCGACGACATCGACAGCGAGCTGCAGAAGACGATCCAGGACAAGCAAATT
TGGCAGTGCCCTACACTGAAGCTTGGACCAGCTCCCCAACGTTTCGAGCTCACCAAGACTCTATTCGACGCCAAG
GTCCCAATGGTCGCCGGCACAGACTCTCCAGCTGGTCAGAATCTGTGTCCCGGCTTCAGTCTCCTCGACGAGCTC
GAGCTGATGAATGAAGCTGGTCTTAGCCAGCTGGAGACGTTGCAGACGGCCACGGTTAACGCTGCCTCCTCACTG
GGGTCCAAAGGGTTGCTGATGGGAACTATCGAAGTTGGAAAGCTGGCGGATATTGTCTTGCTAGACAAGAACCCC
CTTGAAGATATTAGCAACGTGCGCAACATCAGTACCGTCATCGCTGATGGACAAGTCTTTTCGAAAAACGAAATT
GAGAAGATGCTTACGGGGGCGGATCGACTCAGCCAATGTGTTGAACAGCGTGGCACCATAGCTGCGAGAGATCTG
GTAAGTGCTGGTCCGTCATGTTGTTCCGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail