Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2810
Gene name
LocationContig_25:54269..55928
Strand-
Gene length (bp)1659
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup296
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00022
Ophiocordyceps camponoti-floridani Ophcf2|01596
Ophiocordyceps camponoti-floridani Ophcf2|06712
Ophiocordyceps camponoti-rufipedis Ophun1|1283
Ophiocordyceps camponoti-rufipedis Ophun1|2810 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|950
Ophiocordyceps kimflemingae Ophio5|2947
Ophiocordyceps kimflemingae Ophio5|4080
Ophiocordyceps kimflemingae Ophio5|6414
Ophiocordyceps subramaniannii Hirsu2|9518

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2810
MDDNSIVYSYPLHPLDNLSGTRNIFVSWVMRFNDVLDADKLHQSLSRLLEMGDWRKLGGRIRRGKDGKLTILSPK
EFTSLQPAVAFGHDKLPDSTISQHRVASLLPKPGPHAFVGPSGGVNETFRPLTGLAMMPQTLDDIIRIEAPPLSL
HITSFSDATIVALSHPHVLTDGFGVRALLKSWSLVMAGREPDVPALRGATTDLLREAVLEPGSIKPEPHVLASAR
LGKLSKTKMLLKLAADRMKSPEPVQRVMFLPESALRRLFEAEKTSVAAGTKDVLTAWLVRNVAVATAISTHKLPP
PMTVMNAINARLHLPSFIGPDEALAQNMTLMTHTPLARELTAGPVDGIARELRAQTEAQTTEPQVLGLLQSTYRA
LDANQEPLDVYGESSAMPVLVNDLTAVDVYSAVDFSPAVVRRGDAAVWADNPPGTVVYYQLQSKLVNDQKMANVF
TVWGRDRQGNYWLNATLAPKVWTRIEEAFKTLSVPSQAPELPPRKSTAAETTTTTTTATTVTPDSESSPRQSTSQ
PELLTVAEL*
Coding >Ophun1|2810
ATGGACGACAATAGCATCGTCTACTCGTACCCGCTGCACCCGCTCGACAACTTGTCCGGGACGCGCAACATCTTT
GTCTCGTGGGTGATGCGTTTCAATGACGTGCTCGACGCCGACAAGCTCCATCAGTCTCTCTCTCGCCTCCTCGAG
ATGGGAGACTGGCGCAAGCTGGGAGGCCGGATACGACGGGGCAAGGACGGAAAACTCACAATCCTCTCGCCCAAA
GAGTTCACTTCCCTCCAGCCAGCCGTCGCCTTCGGCCACGACAAGCTACCCGACTCGACCATCTCCCAGCACCGC
GTCGCGAGCCTTCTCCCCAAGCCCGGTCCTCACGCCTTCGTCGGTCCCAGCGGCGGCGTCAACGAAACCTTTCGG
CCGCTGACGGGCCTGGCTATGATGCCTCAGACGCTCGACGACATCATTCGTATCGAGGCTCCCCCCCTGTCGCTG
CACATCACCAGCTTCAGCGACGCCACCATCGTCGCCCTGTCCCACCCTCACGTCTTGACCGACGGCTTCGGCGTC
CGCGCCCTGCTGAAGAGCTGGTCGCTCGTGATGGCTGGCCGCGAGCCCGACGTTCCGGCCCTGAGGGGTGCCACG
ACCGACCTTCTCCGCGAGGCCGTCCTGGAACCGGGCTCCATTAAGCCGGAGCCGCACGTTCTGGCTTCAGCCCGC
CTCGGCAAACTCTCCAAGACCAAGATGCTGCTGAAGCTGGCCGCCGATCGGATGAAGAGTCCGGAGCCGGTGCAG
CGCGTCATGTTTCTGCCAGAGTCAGCCCTGAGGCGCCTGTTCGAGGCCGAAAAGACGTCCGTTGCCGCCGGGACC
AAAGACGTCCTCACGGCCTGGCTCGTTCGCAACGTCGCCGTCGCCACCGCCATCTCGACGCACAAGTTGCCGCCC
CCAATGACTGTCATGAACGCCATAAACGCCCGGCTCCATCTGCCGTCTTTCATCGGCCCGGACGAGGCGCTGGCG
CAGAATATGACTCTCATGACGCACACGCCCCTGGCGCGTGAGCTGACGGCCGGCCCCGTCGACGGGATTGCCCGC
GAACTCCGGGCCCAGACTGAGGCCCAGACGACAGAGCCGCAGGTTCTCGGCCTTCTGCAGTCTACCTATCGCGCT
CTCGACGCCAACCAGGAACCGCTCGATGTCTACGGCGAGAGCAGCGCCATGCCGGTCTTGGTCAACGACCTGACC
GCCGTTGATGTCTACAGCGCCGTCGACTTCAGCCCGGCCGTCGTTCGCCGGGGAGATGCGGCTGTCTGGGCCGAT
AATCCGCCTGGAACCGTCGTCTACTATCAGCTGCAGTCCAAGCTTGTCAACGACCAGAAGATGGCAAACGTCTTT
ACCGTCTGGGGGCGTGATCGCCAAGGAAACTACTGGCTCAACGCCACGCTGGCGCCCAAGGTCTGGACCAGGATC
GAGGAGGCCTTCAAGACCTTATCCGTTCCCAGCCAAGCTCCCGAGTTGCCCCCTCGGAAGTCCACAGCTGCCGAG
ACGACGACGACGACGACGACGGCAACGACTGTGACCCCTGACTCGGAGTCGTCCCCGCGGCAGAGCACCAGCCAG
CCGGAGCTTTTGACGGTAGCCGAGTTATGA
Transcript >Ophun1|2810
ATGGACGACAATAGCATCGTCTACTCGTACCCGCTGCACCCGCTCGACAACTTGTCCGGGACGCGCAACATCTTT
GTCTCGTGGGTGATGCGTTTCAATGACGTGCTCGACGCCGACAAGCTCCATCAGTCTCTCTCTCGCCTCCTCGAG
ATGGGAGACTGGCGCAAGCTGGGAGGCCGGATACGACGGGGCAAGGACGGAAAACTCACAATCCTCTCGCCCAAA
GAGTTCACTTCCCTCCAGCCAGCCGTCGCCTTCGGCCACGACAAGCTACCCGACTCGACCATCTCCCAGCACCGC
GTCGCGAGCCTTCTCCCCAAGCCCGGTCCTCACGCCTTCGTCGGTCCCAGCGGCGGCGTCAACGAAACCTTTCGG
CCGCTGACGGGCCTGGCTATGATGCCTCAGACGCTCGACGACATCATTCGTATCGAGGCTCCCCCCCTGTCGCTG
CACATCACCAGCTTCAGCGACGCCACCATCGTCGCCCTGTCCCACCCTCACGTCTTGACCGACGGCTTCGGCGTC
CGCGCCCTGCTGAAGAGCTGGTCGCTCGTGATGGCTGGCCGCGAGCCCGACGTTCCGGCCCTGAGGGGTGCCACG
ACCGACCTTCTCCGCGAGGCCGTCCTGGAACCGGGCTCCATTAAGCCGGAGCCGCACGTTCTGGCTTCAGCCCGC
CTCGGCAAACTCTCCAAGACCAAGATGCTGCTGAAGCTGGCCGCCGATCGGATGAAGAGTCCGGAGCCGGTGCAG
CGCGTCATGTTTCTGCCAGAGTCAGCCCTGAGGCGCCTGTTCGAGGCCGAAAAGACGTCCGTTGCCGCCGGGACC
AAAGACGTCCTCACGGCCTGGCTCGTTCGCAACGTCGCCGTCGCCACCGCCATCTCGACGCACAAGTTGCCGCCC
CCAATGACTGTCATGAACGCCATAAACGCCCGGCTCCATCTGCCGTCTTTCATCGGCCCGGACGAGGCGCTGGCG
CAGAATATGACTCTCATGACGCACACGCCCCTGGCGCGTGAGCTGACGGCCGGCCCCGTCGACGGGATTGCCCGC
GAACTCCGGGCCCAGACTGAGGCCCAGACGACAGAGCCGCAGGTTCTCGGCCTTCTGCAGTCTACCTATCGCGCT
CTCGACGCCAACCAGGAACCGCTCGATGTCTACGGCGAGAGCAGCGCCATGCCGGTCTTGGTCAACGACCTGACC
GCCGTTGATGTCTACAGCGCCGTCGACTTCAGCCCGGCCGTCGTTCGCCGGGGAGATGCGGCTGTCTGGGCCGAT
AATCCGCCTGGAACCGTCGTCTACTATCAGCTGCAGTCCAAGCTTGTCAACGACCAGAAGATGGCAAACGTCTTT
ACCGTCTGGGGGCGTGATCGCCAAGGAAACTACTGGCTCAACGCCACGCTGGCGCCCAAGGTCTGGACCAGGATC
GAGGAGGCCTTCAAGACCTTATCCGTTCCCAGCCAAGCTCCCGAGTTGCCCCCTCGGAAGTCCACAGCTGCCGAG
ACGACGACGACGACGACGACGGCAACGACTGTGACCCCTGACTCGGAGTCGTCCCCGCGGCAGAGCACCAGCCAG
CCGGAGCTTTTGACGGTAGCCGAGTTATGA
Gene >Ophun1|2810
ATGGACGACAATAGCATCGTCTACTCGTACCCGCTGCACCCGCTCGACAACTTGTCCGGGACGCGCAACATCTTT
GTCTCGTGGGTGATGCGTTTCAATGACGTGCTCGACGCCGACAAGCTCCATCAGTCTCTCTCTCGCCTCCTCGAG
ATGGGAGACTGGCGCAAGCTGGGAGGCCGGATACGACGGGGCAAGGTGAGAGGAACAAGGTCGAGTTGAGAGAGT
TGCAACGTCTCTAACAGTCAACAGGACGGAAAACTCACAATCCTCTCGCCCAAAGAGTTCACTTCCCTCCAGCCA
GCCGTCGCCTTCGGCCACGACAAGCTACCCGACTCGACCATCTCCCAGCACCGCGTCGCGAGCCTTCTCCCCAAG
CCCGGTCCTCACGCCTTCGTCGGTCCCAGCGGCGGCGTCAACGAAACCTTTCGGCCGCTGACGGGCCTGGCTATG
ATGCCTCAGACGCTCGACGACATCATTCGTATCGAGGCTCCCCCCCTGTCGCTGCACATCACCAGCTTCAGCGAC
GCCACCATCGTCGCCCTGTCCCACCCTCACGTCTTGACCGACGGCTTCGGCGTCCGCGCCCTGCTGAAGAGCTGG
TCGCTCGTGATGGCTGGCCGCGAGCCCGACGTTCCGGCCCTGAGGGGTGCCACGACCGACCTTCTCCGCGAGGCC
GTCCTGGAACCGGGCTCCATTAAGCCGGAGCCGCACGTTCTGGCTTCAGCCCGCCTCGGCAAACTCTCCAAGACC
AAGATGCTGCTGAAGCTGGCCGCCGATCGGATGAAGAGTCCGGAGCCGGTGCAGCGCGTCATGTTTCTGCCAGAG
TCAGCCCTGAGGCGCCTGTTCGAGGCCGAAAAGACGTCCGTTGCCGCCGGGACCAAAGACGTCCTCACGGCCTGG
CTCGTTCGCAACGTCGCCGTCGCCACCGCCATCTCGACGCACAAGTTGCCGCCCCCAATGACTGTCATGAACGCC
ATAAACGCCCGGCTCCATCTGCCGTCTTTCATCGGCCCGGACGAGGCGCTGGCGCAGAATATGACTCTCATGACG
CACACGCCCCTGGCGCGTGAGCTGACGGCCGGCCCCGTCGACGGGATTGCCCGCGAACTCCGGGCCCAGACTGAG
GCCCAGACGACAGAGCCGCAGGTTCTCGGCCTTCTGCAGTCTACCTATCGCGCTCTCGACGCCAACCAGGAACCG
CTCGATGTCTACGGCGAGAGCAGCGCCATGCCGGTCTTGGTCAACGACCTGACCGCCGTTGATGTCTACAGCGCC
GTCGACTTCAGCCCGGCCGTCGTTCGCCGGGGAGATGCGGCTGTCTGGGCCGATAATCCGCCTGGAACCGTCGTC
TACTATCAGCTGCAGTCCAAGCTTGTCAACGACCAGAAGATGGCAAACGTCTTTACCGTCTGGGGGCGTGATCGC
CAAGGAAACTACTGGCTCAACGCCACGCTGGCGCCCAAGGTCTGGACCAGGATCGAGGAGGCCTTCAAGACCTTA
TCCGTTCCCAGCCAAGCTCCCGAGTTGCCCCCTCGGAAGTCCACAGCTGCCGAGACGACGACGACGACGACGACG
GCAACGACTGTGACCCCTGACTCGGAGTCGTCCCCGCGGCAGAGCACCAGCCAGCCGGAGCTTTTGACGGTAGCC
GAGTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail