Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|28
Gene name
LocationContig_1:70979..72371
Strand+
Gene length (bp)1392
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 3.7E-06 256 454

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZPV8|COAD_ARATH Phosphopantetheine adenylyltransferase OS=Arabidopsis thaliana GN=COAD PE=1 SV=1 251 461 4.0E-19
sp|B9F2L1|COAD2_ORYSJ Phosphopantetheine adenylyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os02g0134000 PE=3 SV=1 251 457 8.0E-19
sp|Q6ZLC4|COAD1_ORYSJ Phosphopantetheine adenylyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os07g0179400 PE=2 SV=1 251 426 1.0E-18
sp|Q10350|YDA8_SCHPO Uncharacterized protein C1F12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.08 PE=4 SV=2 238 417 7.0E-17
sp|Q9DBL7|COASY_MOUSE Bifunctional coenzyme A synthase OS=Mus musculus GN=Coasy PE=1 SV=2 250 454 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZPV8|COAD_ARATH Phosphopantetheine adenylyltransferase OS=Arabidopsis thaliana GN=COAD PE=1 SV=1 251 461 4.0E-19
sp|B9F2L1|COAD2_ORYSJ Phosphopantetheine adenylyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os02g0134000 PE=3 SV=1 251 457 8.0E-19
sp|Q6ZLC4|COAD1_ORYSJ Phosphopantetheine adenylyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os07g0179400 PE=2 SV=1 251 426 1.0E-18
sp|Q10350|YDA8_SCHPO Uncharacterized protein C1F12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.08 PE=4 SV=2 238 417 7.0E-17
sp|Q9DBL7|COASY_MOUSE Bifunctional coenzyme A synthase OS=Mus musculus GN=Coasy PE=1 SV=2 250 454 2.0E-14
sp|P53332|COAD_YEAST Phosphopantetheine adenylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB4 PE=1 SV=1 251 453 6.0E-14
sp|Q5JHE8|COAD_THEKO Phosphopantetheine adenylyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=coaD PE=3 SV=1 251 424 2.0E-13
sp|Q13057|COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4 250 454 1.0E-12
sp|Q9UYT0|COAD_PYRAB Phosphopantetheine adenylyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=coaD PE=1 SV=3 248 424 2.0E-12
sp|O58358|COAD_PYRHO Phosphopantetheine adenylyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=coaD PE=3 SV=2 251 420 2.0E-12
sp|O27918|COAD_METTH Phosphopantetheine adenylyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=coaD PE=3 SV=2 251 419 7.0E-12
sp|Q8U1X0|COAD_PYRFU Phosphopantetheine adenylyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=coaD PE=3 SV=1 257 417 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3172
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7589
Ophiocordyceps australis map64 (Brazil) OphauB2|3726
Ophiocordyceps camponoti-floridani Ophcf2|04767
Ophiocordyceps camponoti-rufipedis Ophun1|28 (this protein)
Ophiocordyceps kimflemingae Ophio5|5742
Ophiocordyceps subramaniannii Hirsu2|5677

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|28
MAGPVLSPDMASTAAPALLLLPSPPQPATRARLHAAYRVPLTAVLTRLSRERAPQILVVAIISSILVQSHTPDSN
ASGIAAESTAPCSVRWRSSQSLLAEIYGLIASISASHNPSPYSDSEKAAAVDARVVLIHRHFSAAFEAPSSSGRR
LSSLAASKSSVVLDLATFAATVRPWSVFFHTSSESGYELLADYLAHAEGRQLVLQSQLVTVDSGISFSSQVPTQR
DAADQSCAQKAQEQDKVDDDDAIVGYKTVCLGGTFDHLHPGHKLLLQAAVLLLKIPDLGEEPCTIIVGISNSELL
AKKEYVEEMQSWDERARSVIAFLATQFNTPTTAAVQVTRSEVDGGNTPTTELRAGFCDGAAVVRCVDIRDPFGPT
ISEEAIDAIVVSGETREGGKAINSRRTDRGWRPLDIYEIDVLDASPSDEDIEGPEDRQQSRHSEAASPAKISSTD
FRRRKAEARARVG*
Coding >Ophun1|28
ATGGCCGGCCCTGTATTATCGCCAGACATGGCCAGCACCGCCGCCCCGGCACTACTTCTCCTGCCGTCGCCTCCG
CAGCCCGCGACCCGAGCTCGTCTTCATGCCGCCTATCGCGTGCCTCTTACGGCCGTCCTCACGCGGCTCAGCCGA
GAACGCGCGCCTCAAATCCTCGTTGTCGCCATTATATCTTCTATTCTGGTGCAGAGTCACACTCCAGATTCGAAC
GCCAGTGGAATCGCGGCCGAGTCGACAGCTCCTTGCTCTGTCCGATGGCGATCCTCACAGTCGCTTCTCGCCGAG
ATCTACGGCTTGATAGCATCTATTAGCGCCAGCCATAACCCCTCCCCTTACTCAGATAGCGAGAAAGCGGCTGCC
GTCGATGCTCGCGTTGTTCTAATTCACCGTCATTTCAGCGCTGCGTTCGAGGCGCCGTCATCATCAGGCCGTCGT
CTTTCTTCCCTCGCGGCCTCAAAGAGCAGTGTCGTTCTAGACCTGGCTACCTTCGCTGCCACGGTTCGACCCTGG
AGCGTTTTCTTTCATACAAGCAGCGAGTCTGGCTACGAGCTGCTCGCTGACTACCTTGCCCATGCCGAGGGGCGA
CAACTGGTTCTGCAAAGCCAGTTGGTAACTGTCGACAGCGGCATAAGCTTTTCTAGCCAAGTCCCGACACAGCGC
GATGCGGCTGACCAGTCTTGTGCGCAAAAAGCGCAAGAGCAAGATAAGGTCGACGATGACGATGCCATCGTGGGG
TATAAAACTGTTTGCTTAGGCGGCACCTTTGATCACCTACACCCCGGCCACAAGTTACTACTTCAAGCCGCTGTC
TTACTTCTCAAAATCCCGGACTTAGGCGAAGAGCCTTGCACAATCATCGTTGGCATATCCAATAGCGAGTTGCTC
GCCAAGAAGGAGTATGTGGAAGAGATGCAGTCATGGGACGAACGCGCCCGATCGGTCATCGCTTTTCTTGCCACG
CAGTTCAACACACCCACTACGGCAGCAGTCCAAGTTACGAGGTCAGAGGTCGACGGCGGCAATACGCCGACAACA
GAGCTTCGAGCCGGCTTCTGTGACGGCGCTGCGGTCGTTCGCTGCGTCGACATTCGCGACCCATTCGGTCCCACT
ATATCCGAAGAGGCCATTGATGCTATCGTCGTCTCAGGGGAGACTCGTGAAGGCGGCAAAGCCATCAACAGTAGG
AGGACAGATCGTGGATGGCGACCGCTTGATATTTATGAGATTGACGTGCTGGATGCGTCTCCGTCTGACGAAGAC
ATCGAAGGCCCCGAGGATCGGCAACAAAGCAGGCATTCGGAAGCCGCGAGTCCAGCCAAAATCAGCAGCACTGAT
TTCCGGAGGCGCAAAGCGGAGGCGCGGGCCCGCGTCGGGTAG
Transcript >Ophun1|28
ATGGCCGGCCCTGTATTATCGCCAGACATGGCCAGCACCGCCGCCCCGGCACTACTTCTCCTGCCGTCGCCTCCG
CAGCCCGCGACCCGAGCTCGTCTTCATGCCGCCTATCGCGTGCCTCTTACGGCCGTCCTCACGCGGCTCAGCCGA
GAACGCGCGCCTCAAATCCTCGTTGTCGCCATTATATCTTCTATTCTGGTGCAGAGTCACACTCCAGATTCGAAC
GCCAGTGGAATCGCGGCCGAGTCGACAGCTCCTTGCTCTGTCCGATGGCGATCCTCACAGTCGCTTCTCGCCGAG
ATCTACGGCTTGATAGCATCTATTAGCGCCAGCCATAACCCCTCCCCTTACTCAGATAGCGAGAAAGCGGCTGCC
GTCGATGCTCGCGTTGTTCTAATTCACCGTCATTTCAGCGCTGCGTTCGAGGCGCCGTCATCATCAGGCCGTCGT
CTTTCTTCCCTCGCGGCCTCAAAGAGCAGTGTCGTTCTAGACCTGGCTACCTTCGCTGCCACGGTTCGACCCTGG
AGCGTTTTCTTTCATACAAGCAGCGAGTCTGGCTACGAGCTGCTCGCTGACTACCTTGCCCATGCCGAGGGGCGA
CAACTGGTTCTGCAAAGCCAGTTGGTAACTGTCGACAGCGGCATAAGCTTTTCTAGCCAAGTCCCGACACAGCGC
GATGCGGCTGACCAGTCTTGTGCGCAAAAAGCGCAAGAGCAAGATAAGGTCGACGATGACGATGCCATCGTGGGG
TATAAAACTGTTTGCTTAGGCGGCACCTTTGATCACCTACACCCCGGCCACAAGTTACTACTTCAAGCCGCTGTC
TTACTTCTCAAAATCCCGGACTTAGGCGAAGAGCCTTGCACAATCATCGTTGGCATATCCAATAGCGAGTTGCTC
GCCAAGAAGGAGTATGTGGAAGAGATGCAGTCATGGGACGAACGCGCCCGATCGGTCATCGCTTTTCTTGCCACG
CAGTTCAACACACCCACTACGGCAGCAGTCCAAGTTACGAGGTCAGAGGTCGACGGCGGCAATACGCCGACAACA
GAGCTTCGAGCCGGCTTCTGTGACGGCGCTGCGGTCGTTCGCTGCGTCGACATTCGCGACCCATTCGGTCCCACT
ATATCCGAAGAGGCCATTGATGCTATCGTCGTCTCAGGGGAGACTCGTGAAGGCGGCAAAGCCATCAACAGTAGG
AGGACAGATCGTGGATGGCGACCGCTTGATATTTATGAGATTGACGTGCTGGATGCGTCTCCGTCTGACGAAGAC
ATCGAAGGCCCCGAGGATCGGCAACAAAGCAGGCATTCGGAAGCCGCGAGTCCAGCCAAAATCAGCAGCACTGAT
TTCCGGAGGCGCAAAGCGGAGGCGCGGGCCCGCGTCGGGTAG
Gene >Ophun1|28
ATGGCCGGCCCTGTATTATCGCCAGACATGGCCAGCACCGCCGCCCCGGCACTACTTCTCCTGCCGTCGCCTCCG
CAGCCCGCGACCCGAGCTCGTCTTCATGCCGCCTATCGCGTGCCTCTTACGGCCGTCCTCACGCGGCTCAGCCGA
GAACGCGCGCCTCAAATCCTCGTTGTCGCCATTATATCTTCTATTCTGGTGCAGAGTCACACTCCAGATTCGAAC
GCCAGTGGAATCGCGGCCGAGTCGACAGCTCCTTGCTCTGTCCGATGGCGATCCTCACAGTCGCTTCTCGCCGAG
ATCTACGGCTTGATAGCATCTATTAGCGCCAGCCATAACCCCTCCCCTTACTCAGATAGCGAGAAAGCGGCTGCC
GTCGATGCTCGCGTTGTTCTAATTCACCGTCATTTCAGCGCTGCGTTCGAGGCGCCGTCATCATCAGGCCGTCGT
CTTTCTTCCCTCGCGGCCTCAAAGAGCAGTGTCGTTCTAGACCTGGCTACCTTCGCTGCCACGGTTCGACCCTGG
AGCGTTTTCTTTCATACAAGCAGCGAGTCTGGCTACGAGCTGCTCGCTGACTACCTTGCCCATGCCGAGGGGCGA
CAACTGGTTCTGCAAAGCCAGTTGGTAACTGTCGACAGCGGCATAAGCTTTTCTAGCCAAGTCCCGACACAGCGC
GATGCGGCTGACCAGTCTTGTGCGCAAAAAGCGCAAGAGCAAGATAAGGTCGACGATGACGATGCCATCGTGGGG
TATAAAACTGTTTGCTTAGGCGGCACCTTTGATCACCTACACCCCGGCCACAAGTTACTACTTCAAGCCGCTGTC
TTACTTCTCAAAATCCCGGACTTAGGCGAAGAGCCTTGCACAATCATCGTTGGCATATCCAATAGCGAGTTGCTC
GCCAAGAAGGAGTATGTGGAAGAGATGCAGTCATGGGACGAACGCGCCCGATCGGTCATCGCTTTTCTTGCCACG
CAGTTCAACACACCCACTACGGCAGCAGTCCAAGTTACGAGGTCAGAGGTCGACGGCGGCAATACGCCGACAACA
GAGCTTCGAGCCGGCTTCTGTGACGGCGCTGCGGTCGTTCGCTGCGTCGACATTCGCGACCCATTCGGTCCCACT
ATATCCGAAGAGGCCATTGATGCTATCGTCGTCTCAGGGGAGACTCGTGAAGGCGGCAAAGCCATCAACAGTAGG
AGGACAGATCGTGGATGGCGACCGCTTGATATTTATGAGATTGACGTGCTGGATGCGTCTCCGTCTGACGAAGAC
ATCGAAGGCCCCGAGGATCGGCAACAAAGCAGGCATTCGGAAGCCGCGAGTCCAGCCAAAATCAGCAGCACTGAT
TTCCGGAGGCGCAAAGCGGAGGCGCGGGCCCGCGTCGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail