Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2798
Gene name
LocationContig_25:14547..17388
Strand-
Gene length (bp)2841
Transcript length (bp)2841
Coding sequence length (bp)2841
Protein length (aa) 947

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 1.5E-17 447 775

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 36 55 19
2 65 87 22
3 100 122 22
4 145 167 22
5 253 272 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2798
MAVVTSFSPARLFVRFLGRRLLLFSTILTRFPDRRFALGLAASGLVSSKLVHIYAHADAVPLQALVLWGPSLFGQ
DTVLLLLLRLLLDNGLLPAPVRASVSAVAVSVCVVVGAMASISVSFFTVAGLELHWRNVGAAVDLSALRMLLTGL
LSMGLVTAALLLLAGILQAPCFLVTGMALDLLRWPLTALLPASIRSWASGCGSVSGSGSDYRHLASRQDSECDYE
DDDDEKYTGSDSASSLDLRSEPASPRRLLVAVYILVGFSLLAQAATYLFRPSDASLVFVSWTLPLLPLVELALSS
SVLARMRGGGGFQGLDENVTALSSRPPPFTWLPVGGKNLEGFEDWYLPDRTHYDATRDPIRVTNLHQPPLPQIRT
ALSRLRIRHVVLLELETIRKDVFPLKKDGIIWRKLANGTDSGKLSAEAEELLSTLTPTANFVTGEYDDGFKHKDR
PKRGGLNFVNAHTSSTYTLKSLTATLCGLTPLLTDFNQEYRNHIYQPCLPHVFEALNRLDGVRKKGGEKRSVARS
DDEGHEEDRDVDEEEGDEEEGDEEEEEEEEEQQQQDADNSSFTSFPWRSTFMQSTTATFDKQTPLMRAFGFRPGS
IIDKEYLRSNRAKFGPSKVKDNNYFSMPEVTLEEYVRDAFSSARRNKERVFLSHLTSTTHHDWKLPANETYVPLT
DDSQLSHLSRFVNCVGYGDRWVRRVLDIIREEGAEDETLVILQGDHGLSNAEIGSLSSYGTGHVGNFHVPLVLSH
PHLPPIDISDAVSSIQVLPTILDLLAESNSLSHSQTIAARDLAANYEGQSLIRPQLNRPSDAGLGSWQFSLINPG
GTMIAVRERGRPGFRLIVPVIDNESWRFTDVETDEHEEKPLVAFDLEVLVADVEKRFGKRAAQWVRKAVAVTSWY
VDENMERWRYGGKRSRKGSMMTTKDPKAKQDTKKANGFKQTKRPMS*
Coding >Ophun1|2798
ATGGCCGTCGTCACCTCCTTTTCACCAGCCCGACTCTTCGTCCGCTTCCTAGGTCGACGACTGCTGCTCTTCTCT
ACCATCTTGACGCGCTTCCCAGACCGACGCTTCGCCCTGGGACTGGCCGCCTCGGGACTCGTCTCCTCCAAGCTG
GTTCACATCTACGCCCACGCGGATGCCGTGCCGCTGCAGGCCTTGGTTCTCTGGGGCCCCTCGCTGTTCGGGCAG
GATACCGTGCTGCTGCTGCTGCTGAGGCTGTTGCTGGACAATGGCCTTCTTCCGGCTCCGGTCCGTGCCTCGGTT
TCGGCCGTGGCCGTGTCCGTGTGCGTCGTTGTCGGCGCAATGGCTTCCATAAGCGTCTCCTTCTTCACCGTTGCC
GGGCTGGAGCTTCACTGGAGAAACGTCGGGGCTGCCGTCGATCTTTCGGCGCTGAGGATGCTGCTAACGGGCCTG
TTGTCTATGGGGCTGGTCACGGCAGCGTTGCTGCTGCTGGCCGGTATCTTGCAGGCCCCCTGCTTCTTAGTGACG
GGCATGGCGCTGGATTTGCTGCGGTGGCCGTTGACTGCGCTGCTGCCGGCCTCAATCCGGAGTTGGGCTTCCGGT
TGCGGCTCCGTCTCCGGCTCCGGCTCCGATTACCGGCATCTCGCCTCTCGGCAAGACAGCGAATGCGACTACGAA
GACGACGACGACGAGAAATACACCGGCTCCGACTCCGCTTCGTCCCTCGATCTCCGGTCCGAGCCGGCAAGTCCT
CGCCGCCTGCTGGTGGCCGTCTACATCCTCGTCGGCTTCTCGCTGCTGGCCCAGGCGGCCACGTACCTCTTCCGT
CCTTCCGACGCCTCGCTCGTCTTCGTCTCCTGGACGCTGCCGCTTCTTCCGCTGGTTGAGCTGGCGCTCTCGTCA
TCCGTCTTGGCCCGCATGCGAGGGGGCGGAGGTTTCCAGGGCCTCGATGAGAACGTTACGGCTCTCTCGAGCCGA
CCACCGCCGTTTACTTGGCTGCCGGTTGGCGGGAAGAATCTCGAAGGCTTCGAGGACTGGTATCTTCCGGACCGG
ACGCACTACGATGCGACGCGGGACCCCATCCGGGTGACCAACCTGCATCAGCCTCCGTTGCCGCAGATTCGAACG
GCATTGAGCCGGCTGCGGATCCGGCACGTCGTTCTCCTTGAACTGGAGACGATTCGGAAGGACGTTTTTCCCCTA
AAGAAGGACGGTATCATCTGGCGGAAGCTCGCCAATGGGACTGATTCGGGAAAGCTATCGGCTGAAGCGGAAGAG
CTGCTCTCGACGCTGACGCCGACGGCCAACTTTGTGACGGGAGAATACGACGATGGCTTCAAGCATAAGGATCGG
CCCAAGAGAGGAGGGCTCAACTTTGTCAATGCGCATACTAGCAGCACTTATACGCTCAAGAGTCTGACGGCGACG
CTGTGCGGGCTGACGCCGCTATTGACGGATTTCAACCAGGAGTATCGCAACCATATCTACCAGCCGTGTTTGCCG
CATGTGTTTGAGGCTTTGAACCGGTTGGATGGCGTTAGAAAGAAGGGAGGGGAGAAGAGGAGCGTTGCCAGGTCC
GACGACGAAGGACATGAAGAGGATCGGGATGTTGATGAGGAAGAAGGAGATGAGGAAGAGGGGGATGAAGAAGAA
GAAGAAGAAGAAGAAGAGCAGCAACAGCAAGACGCAGACAACAGCTCCTTCACGTCCTTCCCCTGGCGCTCAACC
TTTATGCAGTCAACAACCGCAACCTTCGACAAACAAACCCCTCTAATGAGAGCCTTCGGCTTCCGCCCAGGTTCC
ATCATCGACAAGGAGTATCTCCGCAGCAATCGAGCGAAATTCGGCCCCAGCAAAGTAAAGGACAACAACTACTTT
AGCATGCCCGAGGTTACGCTGGAAGAATACGTCCGCGATGCCTTTTCCTCGGCGCGCCGCAACAAGGAGCGCGTC
TTCTTGTCTCATCTTACTAGCACTACCCACCATGATTGGAAGCTGCCTGCCAACGAGACATATGTGCCGTTAACG
GATGACTCGCAGCTGAGCCATCTGTCTCGGTTTGTCAACTGTGTTGGGTATGGGGATCGATGGGTTCGGCGTGTT
CTTGACATTATCCGTGAGGAGGGTGCCGAGGACGAGACGCTCGTCATTCTTCAGGGGGATCACGGCCTGTCCAAC
GCTGAGATTGGAAGCCTCTCGTCGTACGGAACCGGTCACGTCGGCAACTTTCACGTCCCCCTCGTCCTCTCGCAC
CCTCACCTCCCACCTATCGACATCTCCGACGCCGTCTCCTCCATCCAAGTCCTGCCCACGATCCTCGATCTTCTC
GCCGAAAGCAACTCGCTCTCTCATTCCCAGACCATCGCAGCCCGCGACCTAGCCGCCAACTACGAGGGCCAGTCT
CTCATCCGCCCGCAACTCAACAGGCCGAGCGACGCTGGTCTGGGATCCTGGCAGTTCAGCCTCATCAACCCGGGC
GGGACGATGATTGCCGTCCGGGAGAGAGGCCGGCCCGGCTTCCGGCTGATTGTGCCCGTCATCGATAACGAGAGC
TGGCGGTTTACGGATGTCGAGACGGATGAGCACGAGGAGAAGCCTCTTGTCGCGTTTGATCTCGAGGTCTTGGTG
GCTGATGTTGAGAAGAGGTTTGGGAAGAGGGCTGCTCAGTGGGTGAGGAAGGCGGTCGCTGTGACGAGCTGGTAT
GTTGACGAGAACATGGAGAGGTGGCGATACGGCGGCAAGAGGTCGAGGAAGGGATCCATGATGACGACCAAGGAT
CCCAAGGCGAAACAGGACACGAAGAAGGCCAACGGGTTCAAACAGACGAAAAGGCCAATGAGCTAA
Transcript >Ophun1|2798
ATGGCCGTCGTCACCTCCTTTTCACCAGCCCGACTCTTCGTCCGCTTCCTAGGTCGACGACTGCTGCTCTTCTCT
ACCATCTTGACGCGCTTCCCAGACCGACGCTTCGCCCTGGGACTGGCCGCCTCGGGACTCGTCTCCTCCAAGCTG
GTTCACATCTACGCCCACGCGGATGCCGTGCCGCTGCAGGCCTTGGTTCTCTGGGGCCCCTCGCTGTTCGGGCAG
GATACCGTGCTGCTGCTGCTGCTGAGGCTGTTGCTGGACAATGGCCTTCTTCCGGCTCCGGTCCGTGCCTCGGTT
TCGGCCGTGGCCGTGTCCGTGTGCGTCGTTGTCGGCGCAATGGCTTCCATAAGCGTCTCCTTCTTCACCGTTGCC
GGGCTGGAGCTTCACTGGAGAAACGTCGGGGCTGCCGTCGATCTTTCGGCGCTGAGGATGCTGCTAACGGGCCTG
TTGTCTATGGGGCTGGTCACGGCAGCGTTGCTGCTGCTGGCCGGTATCTTGCAGGCCCCCTGCTTCTTAGTGACG
GGCATGGCGCTGGATTTGCTGCGGTGGCCGTTGACTGCGCTGCTGCCGGCCTCAATCCGGAGTTGGGCTTCCGGT
TGCGGCTCCGTCTCCGGCTCCGGCTCCGATTACCGGCATCTCGCCTCTCGGCAAGACAGCGAATGCGACTACGAA
GACGACGACGACGAGAAATACACCGGCTCCGACTCCGCTTCGTCCCTCGATCTCCGGTCCGAGCCGGCAAGTCCT
CGCCGCCTGCTGGTGGCCGTCTACATCCTCGTCGGCTTCTCGCTGCTGGCCCAGGCGGCCACGTACCTCTTCCGT
CCTTCCGACGCCTCGCTCGTCTTCGTCTCCTGGACGCTGCCGCTTCTTCCGCTGGTTGAGCTGGCGCTCTCGTCA
TCCGTCTTGGCCCGCATGCGAGGGGGCGGAGGTTTCCAGGGCCTCGATGAGAACGTTACGGCTCTCTCGAGCCGA
CCACCGCCGTTTACTTGGCTGCCGGTTGGCGGGAAGAATCTCGAAGGCTTCGAGGACTGGTATCTTCCGGACCGG
ACGCACTACGATGCGACGCGGGACCCCATCCGGGTGACCAACCTGCATCAGCCTCCGTTGCCGCAGATTCGAACG
GCATTGAGCCGGCTGCGGATCCGGCACGTCGTTCTCCTTGAACTGGAGACGATTCGGAAGGACGTTTTTCCCCTA
AAGAAGGACGGTATCATCTGGCGGAAGCTCGCCAATGGGACTGATTCGGGAAAGCTATCGGCTGAAGCGGAAGAG
CTGCTCTCGACGCTGACGCCGACGGCCAACTTTGTGACGGGAGAATACGACGATGGCTTCAAGCATAAGGATCGG
CCCAAGAGAGGAGGGCTCAACTTTGTCAATGCGCATACTAGCAGCACTTATACGCTCAAGAGTCTGACGGCGACG
CTGTGCGGGCTGACGCCGCTATTGACGGATTTCAACCAGGAGTATCGCAACCATATCTACCAGCCGTGTTTGCCG
CATGTGTTTGAGGCTTTGAACCGGTTGGATGGCGTTAGAAAGAAGGGAGGGGAGAAGAGGAGCGTTGCCAGGTCC
GACGACGAAGGACATGAAGAGGATCGGGATGTTGATGAGGAAGAAGGAGATGAGGAAGAGGGGGATGAAGAAGAA
GAAGAAGAAGAAGAAGAGCAGCAACAGCAAGACGCAGACAACAGCTCCTTCACGTCCTTCCCCTGGCGCTCAACC
TTTATGCAGTCAACAACCGCAACCTTCGACAAACAAACCCCTCTAATGAGAGCCTTCGGCTTCCGCCCAGGTTCC
ATCATCGACAAGGAGTATCTCCGCAGCAATCGAGCGAAATTCGGCCCCAGCAAAGTAAAGGACAACAACTACTTT
AGCATGCCCGAGGTTACGCTGGAAGAATACGTCCGCGATGCCTTTTCCTCGGCGCGCCGCAACAAGGAGCGCGTC
TTCTTGTCTCATCTTACTAGCACTACCCACCATGATTGGAAGCTGCCTGCCAACGAGACATATGTGCCGTTAACG
GATGACTCGCAGCTGAGCCATCTGTCTCGGTTTGTCAACTGTGTTGGGTATGGGGATCGATGGGTTCGGCGTGTT
CTTGACATTATCCGTGAGGAGGGTGCCGAGGACGAGACGCTCGTCATTCTTCAGGGGGATCACGGCCTGTCCAAC
GCTGAGATTGGAAGCCTCTCGTCGTACGGAACCGGTCACGTCGGCAACTTTCACGTCCCCCTCGTCCTCTCGCAC
CCTCACCTCCCACCTATCGACATCTCCGACGCCGTCTCCTCCATCCAAGTCCTGCCCACGATCCTCGATCTTCTC
GCCGAAAGCAACTCGCTCTCTCATTCCCAGACCATCGCAGCCCGCGACCTAGCCGCCAACTACGAGGGCCAGTCT
CTCATCCGCCCGCAACTCAACAGGCCGAGCGACGCTGGTCTGGGATCCTGGCAGTTCAGCCTCATCAACCCGGGC
GGGACGATGATTGCCGTCCGGGAGAGAGGCCGGCCCGGCTTCCGGCTGATTGTGCCCGTCATCGATAACGAGAGC
TGGCGGTTTACGGATGTCGAGACGGATGAGCACGAGGAGAAGCCTCTTGTCGCGTTTGATCTCGAGGTCTTGGTG
GCTGATGTTGAGAAGAGGTTTGGGAAGAGGGCTGCTCAGTGGGTGAGGAAGGCGGTCGCTGTGACGAGCTGGTAT
GTTGACGAGAACATGGAGAGGTGGCGATACGGCGGCAAGAGGTCGAGGAAGGGATCCATGATGACGACCAAGGAT
CCCAAGGCGAAACAGGACACGAAGAAGGCCAACGGGTTCAAACAGACGAAAAGGCCAATGAGCTAA
Gene >Ophun1|2798
ATGGCCGTCGTCACCTCCTTTTCACCAGCCCGACTCTTCGTCCGCTTCCTAGGTCGACGACTGCTGCTCTTCTCT
ACCATCTTGACGCGCTTCCCAGACCGACGCTTCGCCCTGGGACTGGCCGCCTCGGGACTCGTCTCCTCCAAGCTG
GTTCACATCTACGCCCACGCGGATGCCGTGCCGCTGCAGGCCTTGGTTCTCTGGGGCCCCTCGCTGTTCGGGCAG
GATACCGTGCTGCTGCTGCTGCTGAGGCTGTTGCTGGACAATGGCCTTCTTCCGGCTCCGGTCCGTGCCTCGGTT
TCGGCCGTGGCCGTGTCCGTGTGCGTCGTTGTCGGCGCAATGGCTTCCATAAGCGTCTCCTTCTTCACCGTTGCC
GGGCTGGAGCTTCACTGGAGAAACGTCGGGGCTGCCGTCGATCTTTCGGCGCTGAGGATGCTGCTAACGGGCCTG
TTGTCTATGGGGCTGGTCACGGCAGCGTTGCTGCTGCTGGCCGGTATCTTGCAGGCCCCCTGCTTCTTAGTGACG
GGCATGGCGCTGGATTTGCTGCGGTGGCCGTTGACTGCGCTGCTGCCGGCCTCAATCCGGAGTTGGGCTTCCGGT
TGCGGCTCCGTCTCCGGCTCCGGCTCCGATTACCGGCATCTCGCCTCTCGGCAAGACAGCGAATGCGACTACGAA
GACGACGACGACGAGAAATACACCGGCTCCGACTCCGCTTCGTCCCTCGATCTCCGGTCCGAGCCGGCAAGTCCT
CGCCGCCTGCTGGTGGCCGTCTACATCCTCGTCGGCTTCTCGCTGCTGGCCCAGGCGGCCACGTACCTCTTCCGT
CCTTCCGACGCCTCGCTCGTCTTCGTCTCCTGGACGCTGCCGCTTCTTCCGCTGGTTGAGCTGGCGCTCTCGTCA
TCCGTCTTGGCCCGCATGCGAGGGGGCGGAGGTTTCCAGGGCCTCGATGAGAACGTTACGGCTCTCTCGAGCCGA
CCACCGCCGTTTACTTGGCTGCCGGTTGGCGGGAAGAATCTCGAAGGCTTCGAGGACTGGTATCTTCCGGACCGG
ACGCACTACGATGCGACGCGGGACCCCATCCGGGTGACCAACCTGCATCAGCCTCCGTTGCCGCAGATTCGAACG
GCATTGAGCCGGCTGCGGATCCGGCACGTCGTTCTCCTTGAACTGGAGACGATTCGGAAGGACGTTTTTCCCCTA
AAGAAGGACGGTATCATCTGGCGGAAGCTCGCCAATGGGACTGATTCGGGAAAGCTATCGGCTGAAGCGGAAGAG
CTGCTCTCGACGCTGACGCCGACGGCCAACTTTGTGACGGGAGAATACGACGATGGCTTCAAGCATAAGGATCGG
CCCAAGAGAGGAGGGCTCAACTTTGTCAATGCGCATACTAGCAGCACTTATACGCTCAAGAGTCTGACGGCGACG
CTGTGCGGGCTGACGCCGCTATTGACGGATTTCAACCAGGAGTATCGCAACCATATCTACCAGCCGTGTTTGCCG
CATGTGTTTGAGGCTTTGAACCGGTTGGATGGCGTTAGAAAGAAGGGAGGGGAGAAGAGGAGCGTTGCCAGGTCC
GACGACGAAGGACATGAAGAGGATCGGGATGTTGATGAGGAAGAAGGAGATGAGGAAGAGGGGGATGAAGAAGAA
GAAGAAGAAGAAGAAGAGCAGCAACAGCAAGACGCAGACAACAGCTCCTTCACGTCCTTCCCCTGGCGCTCAACC
TTTATGCAGTCAACAACCGCAACCTTCGACAAACAAACCCCTCTAATGAGAGCCTTCGGCTTCCGCCCAGGTTCC
ATCATCGACAAGGAGTATCTCCGCAGCAATCGAGCGAAATTCGGCCCCAGCAAAGTAAAGGACAACAACTACTTT
AGCATGCCCGAGGTTACGCTGGAAGAATACGTCCGCGATGCCTTTTCCTCGGCGCGCCGCAACAAGGAGCGCGTC
TTCTTGTCTCATCTTACTAGCACTACCCACCATGATTGGAAGCTGCCTGCCAACGAGACATATGTGCCGTTAACG
GATGACTCGCAGCTGAGCCATCTGTCTCGGTTTGTCAACTGTGTTGGGTATGGGGATCGATGGGTTCGGCGTGTT
CTTGACATTATCCGTGAGGAGGGTGCCGAGGACGAGACGCTCGTCATTCTTCAGGGGGATCACGGCCTGTCCAAC
GCTGAGATTGGAAGCCTCTCGTCGTACGGAACCGGTCACGTCGGCAACTTTCACGTCCCCCTCGTCCTCTCGCAC
CCTCACCTCCCACCTATCGACATCTCCGACGCCGTCTCCTCCATCCAAGTCCTGCCCACGATCCTCGATCTTCTC
GCCGAAAGCAACTCGCTCTCTCATTCCCAGACCATCGCAGCCCGCGACCTAGCCGCCAACTACGAGGGCCAGTCT
CTCATCCGCCCGCAACTCAACAGGCCGAGCGACGCTGGTCTGGGATCCTGGCAGTTCAGCCTCATCAACCCGGGC
GGGACGATGATTGCCGTCCGGGAGAGAGGCCGGCCCGGCTTCCGGCTGATTGTGCCCGTCATCGATAACGAGAGC
TGGCGGTTTACGGATGTCGAGACGGATGAGCACGAGGAGAAGCCTCTTGTCGCGTTTGATCTCGAGGTCTTGGTG
GCTGATGTTGAGAAGAGGTTTGGGAAGAGGGCTGCTCAGTGGGTGAGGAAGGCGGTCGCTGTGACGAGCTGGTAT
GTTGACGAGAACATGGAGAGGTGGCGATACGGCGGCAAGAGGTCGAGGAAGGGATCCATGATGACGACCAAGGAT
CCCAAGGCGAAACAGGACACGAAGAAGGCCAACGGGTTCAAACAGACGAAAAGGCCAATGAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail