Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2785
Gene name
LocationContig_249:5671..7332
Strand+
Gene length (bp)1661
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 1.2E-44 31 370
PF11954 DUF3471 Domain of unknown function (DUF3471) 3.5E-08 412 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 30 359 2.0E-12
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 30 359 4.0E-12
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 30 359 6.0E-12
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 30 359 6.0E-12
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 30 359 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 30 359 2.0E-12
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 30 359 4.0E-12
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 30 359 6.0E-12
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 30 359 6.0E-12
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 30 359 3.0E-11
sp|Q6GDZ1|FLP_STAAR Protein flp OS=Staphylococcus aureus (strain MRSA252) GN=flp PE=3 SV=1 30 359 3.0E-11
sp|Q9KJ74|FLP_STAAU Protein flp OS=Staphylococcus aureus GN=flp PE=4 SV=1 30 359 2.0E-10
sp|Q2FVH6|FLP_STAA8 Protein flp OS=Staphylococcus aureus (strain NCTC 8325) GN=flp PE=4 SV=1 30 359 2.0E-10
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 78 371 9.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999634

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup422
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7089
Ophiocordyceps australis map64 (Brazil) OphauB2|7049
Ophiocordyceps camponoti-floridani Ophcf2|01982
Ophiocordyceps camponoti-rufipedis Ophun1|2785 (this protein)
Ophiocordyceps kimflemingae Ophio5|4027
Ophiocordyceps subramaniannii Hirsu2|3858
Ophiocordyceps subramaniannii Hirsu2|5496
Ophiocordyceps subramaniannii Hirsu2|8281

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2785
MRSAFIAAGLVLVLSAAEQQPSTLSPFTDEFSRFVEDALHQYHTAGLSIAIIDQGRITSQGYGNATLPDTPAKPN
TLWYVGSTTKALVAAVLAQLIDSNTYPQLARGWRTPISSLIRDDFVLQDAWSTHHVTLEDAATHMSGLTAHDESL
RYSPNASLHIVRDTVRNLRNLPIHLEPHQEFHYNNQMYTVLQHVVETLTGRWLGHLLQDMLWRPLSMNSTYFDLK
QALAAPEHLSTGYYWHRGQRKLKPMPLMPTDPMNASGAVISTVVDFAAWVRCLLRRSEPLSPSVHKELRKPRAVQ
SPEPAMGTDVTLYSLGWFRTTLYGQTAYWHSGSVETHGALIYWFPDLDYGVVLFANYPSTVRFVVMWRLIEDKLR
VPKDKRFDIGQKMRQDDEKDRRSIANATNILFPDRPRPPLPSSLKPSQLAGRYRHPGYGTFDLRPERKASGEAET
ILVADRDDFEVRYQLRLHHVSGEYWAVFIESPDREPGPSAFYRAQFNLGSHGRVTSLAITMFNREENVLEGVVVY
ERVA*
Coding >Ophun1|2785
ATGAGAAGCGCCTTCATCGCGGCTGGCCTCGTGCTGGTCCTCTCTGCCGCCGAGCAGCAACCCAGCACCCTCAGT
CCCTTCACCGACGAGTTCAGCCGCTTCGTTGAAGACGCGCTGCATCAGTATCACACAGCAGGACTCTCCATCGCC
ATCATCGACCAAGGCCGCATCACCTCACAGGGCTATGGCAACGCCACCCTCCCCGACACGCCAGCCAAGCCCAAC
ACGCTGTGGTACGTCGGATCCACGACAAAAGCCCTCGTCGCCGCTGTCCTGGCCCAGCTCATCGACTCCAACACC
TACCCGCAACTGGCCCGCGGATGGAGGACGCCCATCTCGTCCCTGATACGCGATGACTTCGTCCTTCAGGATGCC
TGGTCGACGCATCACGTCACGCTCGAGGACGCGGCTACCCACATGTCCGGCCTGACAGCCCATGACGAGAGCCTG
CGATACTCGCCCAACGCCTCGCTCCACATCGTCCGCGATACCGTCCGCAACCTCCGCAACCTGCCCATCCATCTC
GAGCCTCACCAAGAGTTCCACTATAACAACCAGATGTACACGGTGCTGCAGCACGTCGTCGAGACGCTGACGGGC
AGGTGGCTCGGCCATCTGCTCCAGGACATGCTCTGGCGTCCGCTCTCCATGAACTCGACCTACTTCGACCTGAAG
CAGGCCCTCGCCGCTCCAGAGCACCTCTCAACCGGATACTACTGGCACCGAGGCCAGCGCAAGCTCAAGCCCATG
CCCCTGATGCCAACCGACCCCATGAACGCCTCCGGAGCCGTCATCTCCACCGTCGTCGACTTCGCCGCCTGGGTC
CGCTGCCTGCTGCGCCGCTCCGAGCCGCTCTCCCCCTCGGTCCACAAGGAGCTGCGCAAGCCGCGCGCCGTGCAG
AGCCCGGAGCCCGCCATGGGCACCGACGTCACCCTCTACTCGCTCGGCTGGTTCCGCACCACGCTGTACGGCCAG
ACGGCCTACTGGCACTCCGGCTCTGTCGAGACGCACGGCGCCCTCATCTACTGGTTCCCGGACCTCGACTATGGC
GTCGTCTTGTTCGCAAACTACCCGAGCACCGTGCGCTTCGTCGTCATGTGGCGTCTGATCGAGGACAAGCTGCGC
GTCCCCAAAGATAAGCGGTTCGACATTGGTCAAAAGATGAGACAAGATGATGAAAAGGACCGCCGCAGCATCGCC
AACGCCACCAACATCCTCTTCCCCGACAGACCGCGTCCTCCCCTGCCGTCCTCGCTGAAGCCGTCACAGCTGGCC
GGCCGCTATCGCCATCCGGGATACGGCACCTTTGACCTGCGGCCGGAGCGGAAGGCGTCCGGGGAGGCGGAGACG
ATACTGGTGGCGGACCGCGACGACTTCGAGGTGCGGTACCAGCTGAGGCTTCACCACGTCTCGGGCGAGTATTGG
GCCGTCTTCATCGAGTCGCCTGATCGTGAGCCGGGGCCGAGCGCCTTCTACCGCGCCCAGTTCAATCTGGGGAGT
CATGGCAGGGTGACGAGTCTGGCCATTACCATGTTTAACCGGGAAGAGAATGTCTTGGAGGGGGTCGTGGTTTAC
GAGCGGGTGGCCTGA
Transcript >Ophun1|2785
ATGAGAAGCGCCTTCATCGCGGCTGGCCTCGTGCTGGTCCTCTCTGCCGCCGAGCAGCAACCCAGCACCCTCAGT
CCCTTCACCGACGAGTTCAGCCGCTTCGTTGAAGACGCGCTGCATCAGTATCACACAGCAGGACTCTCCATCGCC
ATCATCGACCAAGGCCGCATCACCTCACAGGGCTATGGCAACGCCACCCTCCCCGACACGCCAGCCAAGCCCAAC
ACGCTGTGGTACGTCGGATCCACGACAAAAGCCCTCGTCGCCGCTGTCCTGGCCCAGCTCATCGACTCCAACACC
TACCCGCAACTGGCCCGCGGATGGAGGACGCCCATCTCGTCCCTGATACGCGATGACTTCGTCCTTCAGGATGCC
TGGTCGACGCATCACGTCACGCTCGAGGACGCGGCTACCCACATGTCCGGCCTGACAGCCCATGACGAGAGCCTG
CGATACTCGCCCAACGCCTCGCTCCACATCGTCCGCGATACCGTCCGCAACCTCCGCAACCTGCCCATCCATCTC
GAGCCTCACCAAGAGTTCCACTATAACAACCAGATGTACACGGTGCTGCAGCACGTCGTCGAGACGCTGACGGGC
AGGTGGCTCGGCCATCTGCTCCAGGACATGCTCTGGCGTCCGCTCTCCATGAACTCGACCTACTTCGACCTGAAG
CAGGCCCTCGCCGCTCCAGAGCACCTCTCAACCGGATACTACTGGCACCGAGGCCAGCGCAAGCTCAAGCCCATG
CCCCTGATGCCAACCGACCCCATGAACGCCTCCGGAGCCGTCATCTCCACCGTCGTCGACTTCGCCGCCTGGGTC
CGCTGCCTGCTGCGCCGCTCCGAGCCGCTCTCCCCCTCGGTCCACAAGGAGCTGCGCAAGCCGCGCGCCGTGCAG
AGCCCGGAGCCCGCCATGGGCACCGACGTCACCCTCTACTCGCTCGGCTGGTTCCGCACCACGCTGTACGGCCAG
ACGGCCTACTGGCACTCCGGCTCTGTCGAGACGCACGGCGCCCTCATCTACTGGTTCCCGGACCTCGACTATGGC
GTCGTCTTGTTCGCAAACTACCCGAGCACCGTGCGCTTCGTCGTCATGTGGCGTCTGATCGAGGACAAGCTGCGC
GTCCCCAAAGATAAGCGGTTCGACATTGGTCAAAAGATGAGACAAGATGATGAAAAGGACCGCCGCAGCATCGCC
AACGCCACCAACATCCTCTTCCCCGACAGACCGCGTCCTCCCCTGCCGTCCTCGCTGAAGCCGTCACAGCTGGCC
GGCCGCTATCGCCATCCGGGATACGGCACCTTTGACCTGCGGCCGGAGCGGAAGGCGTCCGGGGAGGCGGAGACG
ATACTGGTGGCGGACCGCGACGACTTCGAGGTGCGGTACCAGCTGAGGCTTCACCACGTCTCGGGCGAGTATTGG
GCCGTCTTCATCGAGTCGCCTGATCGTGAGCCGGGGCCGAGCGCCTTCTACCGCGCCCAGTTCAATCTGGGGAGT
CATGGCAGGGTGACGAGTCTGGCCATTACCATGTTTAACCGGGAAGAGAATGTCTTGGAGGGGGTCGTGGTTTAC
GAGCGGGTGGCCTGA
Gene >Ophun1|2785
ATGAGAAGCGCCTTCATCGCGGCTGGCCTCGTGCTGGTCCTCTCTGCCGCCGAGCAGCAACCCAGCACCCTCAGT
CCCTTCACCGACGAGTTCAGCCGCTTCGTTGAAGACGCGCTGCATCAGTATCACACAGCAGGACTCTCCATCGCC
ATCATCGACCAAGGCCGCATCACCTCACAGGGCTATGGCAACGCCACCCTCCCCGACACGCCAGCCAAGCCCAAC
ACGCTGTGGTACGTCGGATCCACGACAAAAGCCCTCGTCGCCGCTGTCCTGGCCCAGCTCATCGACTCCAACACC
TACCCGCAACTGGCCCGCGGATGGAGGACGCCCATCTCGTCCCTGATACGCGATGACTTCGTCCTTCAGGATGCC
TGGTCGACGCATCACGTCACGCTCGAGGACGCGGCTACCCACATGTCCGGCCTGACAGCCCATGACGAGAGCCTG
CGATACTCGCCCAACGCCTCGCTCCACATCGTCCGCGATACCGTCCGCAACCTCCGCAACCTGCCCATCCATCTC
GAGCCTCACCAAGAGTTCCACTATAACAACCAGATGTACACGGTGCTGCAGCACGTCGTCGAGACGCTGACGGGC
AGGTGGCTCGGCCATCTGCTCCAGGACATGCTCTGGCGTCCGCTCTCCATGAACTCGACCTACTTCGACCTGAAG
CAGGCCCTCGCCGCTCCAGAGCACCTCTCAACCGGATACTACTGGCACCGAGGCCAGCGCAAGCTCAAGCCCATG
CCCCTGATGCCAACCGACCCCATGAACGCCTCCGGAGCCGTCATCTCCACCGTCGTCGACTTCGCCGCCTGGGTC
CGCTGCCTGCTGCGCCGCTCCGAGCCGCTCTCCCCCTCGGTCCACAAGGAGCTGCGCAAGCCGCGCGCCGTGCAG
AGCCCGGAGCCCGCCATGGGCACCGACGTCACCCTCTACTCGCTCGGCTGGTTCCGCACCACGCTGTACGGCCAG
ACGGCCTACTGGCACTCCGGCTCTGTCGAGACGCACGGCGCCCTCATCTACTGGTTCCCGGACCTCGACTATGGC
GTCGTCTTGTTCGCAAACTACCCGAGCACCGTGCGCTTCGTCGTCATGTGGCGTCTGATCGAGGACAAGCTGCGC
GTCCCCAAAGATAAGCGGTTCGACATTGGTCAAAAGTCAATCAATCTCCTTTCCTTACCTTTGCTTGCCCTGTGC
ATGAGCTGACGACGCCGCCGCCATCATCCAGGATGAGACAAGATGATGAAAAGGACCGCCGCAGCATCGCCAACG
CCACCAACATCCTCTTCCCCGACAGACCGCGTCCTCCCCTGCCGTCCTCGCTGAAGCCGTCACAGCTGGCCGGCC
GCTATCGCCATCCGGGATACGGCACCTTTGACCTGCGGCCGGAGCGGAAGGCGTCCGGGGAGGCGGAGACGATAC
TGGTGGCGGACCGCGACGACTTCGAGGTGCGGTACCAGCTGAGGCTTCACCACGTCTCGGGCGAGTATTGGGCCG
TCTTCATCGAGTCGCCTGATCGTGAGCCGGGGCCGAGCGCCTTCTACCGCGCCCAGTTCAATCTGGGGAGTCATG
GCAGGGTGACGAGTCTGGCCATTACCATGTTTAACCGGGAAGAGAATGTCTTGGAGGGGGTCGTGGTTTACGAGC
GGGTGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail