Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|278
Gene name
LocationContig_107:21341..23947
Strand+
Gene length (bp)2606
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain 2.3E-55 1 123
PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain 6.7E-48 127 254
PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase 8.6E-11 380 507
PF00294 PfkB pfkB family carbohydrate kinase 5.4E-06 399 453

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03392|PCNA_SCHPO Proliferating cell nuclear antigen OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcn1 PE=1 SV=1 1 255 5.0E-120
sp|O82797|PCNA_TOBAC Proliferating cell nuclear antigen OS=Nicotiana tabacum GN=PCNA PE=2 SV=1 1 257 3.0E-101
sp|Q00268|PCNA1_DAUCA Proliferating cell nuclear antigen OS=Daucus carota PE=3 SV=1 1 257 6.0E-100
sp|Q43124|PCNA_BRANA Proliferating cell nuclear antigen OS=Brassica napus PE=2 SV=1 1 264 4.0E-99
sp|Q9M7Q7|PCNA1_ARATH Proliferating cellular nuclear antigen 1 OS=Arabidopsis thaliana GN=PCNA PE=1 SV=2 1 257 1.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03392|PCNA_SCHPO Proliferating cell nuclear antigen OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcn1 PE=1 SV=1 1 255 5.0E-120
sp|O82797|PCNA_TOBAC Proliferating cell nuclear antigen OS=Nicotiana tabacum GN=PCNA PE=2 SV=1 1 257 3.0E-101
sp|Q00268|PCNA1_DAUCA Proliferating cell nuclear antigen OS=Daucus carota PE=3 SV=1 1 257 6.0E-100
sp|Q43124|PCNA_BRANA Proliferating cell nuclear antigen OS=Brassica napus PE=2 SV=1 1 264 4.0E-99
sp|Q9M7Q7|PCNA1_ARATH Proliferating cellular nuclear antigen 1 OS=Arabidopsis thaliana GN=PCNA PE=1 SV=2 1 257 1.0E-98
sp|Q9ZW35|PCNA2_ARATH Proliferating cell nuclear antigen 2 OS=Arabidopsis thaliana GN=PCNA2 PE=1 SV=1 1 257 2.0E-98
sp|P24314|PCNA_CATRO Proliferating cell nuclear antigen OS=Catharanthus roseus PE=2 SV=1 1 266 1.0E-97
sp|Q43266|PCNA_MAIZE Proliferating cell nuclear antigen OS=Zea mays GN=PCNA PE=2 SV=1 1 256 2.0E-97
sp|Q00265|PCNA2_DAUCA Proliferating cell nuclear antigen large form OS=Daucus carota PE=2 SV=1 1 274 4.0E-97
sp|Q9MAY3|PCNA_POPNI Proliferating cell nuclear antigen OS=Populus nigra GN=PCNA PE=2 SV=1 1 257 5.0E-97
sp|O82134|PCNA_PEA Proliferating cell nuclear antigen OS=Pisum sativum GN=PCNA PE=2 SV=1 1 257 3.0E-96
sp|P17070|PCNA_ORYSJ Proliferating cell nuclear antigen OS=Oryza sativa subsp. japonica GN=Os02g0805200 PE=2 SV=2 1 257 4.0E-96
sp|P17917|PCNA_DROME Proliferating cell nuclear antigen OS=Drosophila melanogaster GN=PCNA PE=1 SV=2 1 256 2.0E-93
sp|Q9DEA3|PCNA_CHICK Proliferating cell nuclear antigen OS=Gallus gallus GN=PCNA PE=1 SV=1 1 256 8.0E-91
sp|P61258|PCNA_MACFA Proliferating cell nuclear antigen OS=Macaca fascicularis GN=PCNA PE=2 SV=1 1 256 2.0E-90
sp|P12004|PCNA_HUMAN Proliferating cell nuclear antigen OS=Homo sapiens GN=PCNA PE=1 SV=1 1 256 2.0E-90
sp|Q9DDF1|PCNA_COTJA Proliferating cell nuclear antigen OS=Coturnix coturnix japonica GN=PCNA PE=2 SV=1 1 256 4.0E-90
sp|P57761|PCNA_CRIGR Proliferating cell nuclear antigen OS=Cricetulus griseus GN=PCNA PE=1 SV=1 1 256 6.0E-90
sp|O01377|PCNA_BOMMO Proliferating cell nuclear antigen OS=Bombyx mori GN=PCNA PE=2 SV=1 1 257 6.0E-90
sp|Q3ZBW4|PCNA_BOVIN Proliferating cell nuclear antigen OS=Bos taurus GN=PCNA PE=2 SV=1 1 256 7.0E-90
sp|P04961|PCNA_RAT Proliferating cell nuclear antigen OS=Rattus norvegicus GN=Pcna PE=1 SV=1 1 256 2.0E-89
sp|P17918|PCNA_MOUSE Proliferating cell nuclear antigen OS=Mus musculus GN=Pcna PE=1 SV=2 1 256 7.0E-89
sp|O16852|PCNA_SARCR Proliferating cell nuclear antigen OS=Sarcophaga crassipalpis GN=PCNA PE=3 SV=1 1 256 8.0E-89
sp|Q9PTP1|PCNA_DANRE Proliferating cell nuclear antigen OS=Danio rerio GN=pcna PE=1 SV=2 1 255 2.0E-87
sp|Q6B6N4|PCNA_HAPBU Proliferating cell nuclear antigen OS=Haplochromis burtoni GN=pcna PE=2 SV=1 1 255 3.0E-87
sp|P18248|PCNA_XENLA Proliferating cell nuclear antigen OS=Xenopus laevis GN=pcna PE=2 SV=1 1 256 8.0E-86
sp|P53358|PCNA_STYCL Proliferating cell nuclear antigen OS=Styela clava GN=PCNA PE=2 SV=1 1 265 3.0E-85
sp|P22177|PCNA_SOYBN Proliferating cell nuclear antigen (Fragment) OS=Glycine max PE=2 SV=1 33 265 7.0E-85
sp|Q9W644|PCNA_ANGJA Proliferating cell nuclear antigen OS=Anguilla japonica GN=pcna PE=2 SV=1 1 255 1.0E-84
sp|P15873|PCNA_YEAST Proliferating cell nuclear antigen OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL30 PE=1 SV=1 1 254 5.0E-75
sp|O02115|PCNA_CAEEL Proliferating cell nuclear antigen OS=Caenorhabditis elegans GN=pcn-1 PE=1 SV=3 1 255 7.0E-75
sp|Q54K47|PCNA_DICDI Proliferating cell nuclear antigen OS=Dictyostelium discoideum GN=pcna PE=3 SV=1 1 256 3.0E-73
sp|P11038|PCNA_NPVAC Probable DNA polymerase sliding clamp OS=Autographa californica nuclear polyhedrosis virus GN=PCNA PE=2 SV=1 1 255 3.0E-60
sp|O14242|YELB_SCHPO Putative pyridoxal kinase C6F6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.11c PE=3 SV=2 285 604 1.0E-50
sp|P31008|PCNA_PLAFK Proliferating cell nuclear antigen OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PCNA PE=3 SV=1 1 253 5.0E-50
sp|P61074|PCNA_PLAF7 Proliferating cell nuclear antigen OS=Plasmodium falciparum (isolate 3D7) GN=PCNA PE=3 SV=1 1 253 5.0E-50
sp|O00764|PDXK_HUMAN Pyridoxal kinase OS=Homo sapiens GN=PDXK PE=1 SV=1 283 604 2.0E-45
sp|Q0II59|PDXK_BOVIN Pyridoxal kinase OS=Bos taurus GN=PDXK PE=2 SV=1 283 604 3.0E-45
sp|P82197|PDXK_SHEEP Pyridoxal kinase OS=Ovis aries GN=PDXK PE=1 SV=1 283 604 4.0E-45
sp|O46560|PDXK_PIG Pyridoxal kinase OS=Sus scrofa GN=PDXK PE=1 SV=1 283 604 3.0E-44
sp|O35331|PDXK_RAT Pyridoxal kinase OS=Rattus norvegicus GN=Pdxk PE=1 SV=1 283 604 6.0E-44
sp|O74860|YQ9A_SCHPO Putative pyridoxal kinase C18.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.10 PE=3 SV=1 266 605 6.0E-42
sp|Q8K183|PDXK_MOUSE Pyridoxal kinase OS=Mus musculus GN=Pdxk PE=1 SV=1 283 604 1.0E-41
sp|P39988|BUD16_YEAST Putative pyridoxal kinase BUD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD16 PE=1 SV=1 285 593 3.0E-39
sp|Q8W1X2|PDXK_ARATH Pyridoxal kinase OS=Arabidopsis thaliana GN=PK PE=1 SV=2 283 605 4.0E-39
sp|Q55EK9|PDXK_DICDI Pyridoxal kinase OS=Dictyostelium discoideum GN=pykA PE=1 SV=1 285 607 6.0E-38
sp|Q84513|PCNA1_PBCV1 Probable DNA polymerase sliding clamp 1 OS=Paramecium bursaria Chlorella virus 1 GN=A193L PE=3 SV=1 1 253 3.0E-37
sp|P53727|BUD17_YEAST Putative pyridoxal kinase BUD17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD17 PE=1 SV=1 285 597 1.0E-35
sp|O10308|PCNA_NPVOP Probable DNA polymerase sliding clamp OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=PCNA PE=3 SV=1 13 255 1.0E-31
sp|O01824|PDXK_CAEEL Putative pyridoxal kinase OS=Caenorhabditis elegans GN=F57C9.1 PE=3 SV=2 285 599 7.0E-31
sp|A6UQZ4|PCNA_METVS DNA polymerase sliding clamp OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pcn PE=3 SV=1 12 256 9.0E-31
sp|Q57697|PCNA_METJA DNA polymerase sliding clamp OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pcn PE=3 SV=1 1 256 3.0E-29
sp|Q6NG19|PDXY_CORDI Pyridoxamine kinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pdxY PE=3 SV=2 285 516 6.0E-29
sp|A9A8V2|PCNA_METM6 DNA polymerase sliding clamp OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pcn PE=3 SV=1 12 256 2.0E-26
sp|Q6LWJ8|PCNA_METMP DNA polymerase sliding clamp OS=Methanococcus maripaludis (strain S2 / LL) GN=pcn PE=3 SV=1 12 256 3.0E-26
sp|A6VHX7|PCNA_METM7 DNA polymerase sliding clamp OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pcn PE=3 SV=1 12 256 3.0E-26
sp|A4G0K8|PCNA_METM5 DNA polymerase sliding clamp OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pcn PE=3 SV=1 12 256 2.0E-25
sp|Q1J237|PDXY_DEIGD Pyridoxamine kinase OS=Deinococcus geothermalis (strain DSM 11300) GN=pdxY PE=3 SV=1 285 504 4.0E-25
sp|A0RXH7|PCNA_CENSY DNA polymerase sliding clamp OS=Cenarchaeum symbiosum (strain A) GN=pcn PE=3 SV=1 2 255 5.0E-25
sp|Q9RYX0|PDXY_DEIRA Pyridoxamine kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pdxY PE=3 SV=2 285 504 3.0E-24
sp|Q0BSF0|PDXY_GRABC Pyridoxamine kinase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pdxY PE=3 SV=2 284 504 7.0E-24
sp|Q1AYE5|PDXY_RUBXD Pyridoxamine kinase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pdxY PE=3 SV=1 285 439 5.0E-23
sp|A6UUW0|PCNA_META3 DNA polymerase sliding clamp OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pcn PE=3 SV=1 1 256 5.0E-23
sp|Q6AFC1|PDXY_LEIXX Pyridoxamine kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pdxY PE=3 SV=1 285 516 1.0E-21
sp|A9A2X4|PCNA_NITMS DNA polymerase sliding clamp OS=Nitrosopumilus maritimus (strain SCM1) GN=pcn PE=3 SV=1 4 256 1.0E-21
sp|A5UMB4|PCNA_METS3 DNA polymerase sliding clamp OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=pcn PE=3 SV=1 1 262 3.0E-21
sp|O27367|PCNA_METTH DNA polymerase sliding clamp OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pcn PE=3 SV=1 1 255 3.0E-21
sp|O41056|PCNA2_PBCV1 Probable DNA polymerase sliding clamp 2 OS=Paramecium bursaria Chlorella virus 1 GN=A574L PE=3 SV=1 9 263 3.0E-21
sp|O58398|PCNA_PYRHO DNA polymerase sliding clamp OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pcn PE=3 SV=1 2 255 2.0E-20
sp|Q1I2L8|PDXY_PSEE4 Pyridoxamine kinase OS=Pseudomonas entomophila (strain L48) GN=pdxY PE=3 SV=1 285 605 5.0E-20
sp|B0UUD2|PDXY_HISS2 Pyridoxamine kinase OS=Histophilus somni (strain 2336) GN=pdxY PE=3 SV=1 285 441 2.0E-19
sp|Q0I3D2|PDXY_HAES1 Pyridoxamine kinase OS=Haemophilus somnus (strain 129Pt) GN=pdxY PE=3 SV=1 285 441 2.0E-19
sp|Q3K4B8|PDXY_PSEPF Pyridoxamine kinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pdxY PE=3 SV=1 285 607 3.0E-19
sp|Q8ZTY0|PCNA1_PYRAE DNA polymerase sliding clamp 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pcn1 PE=3 SV=1 15 255 7.0E-19
sp|Q9UYX8|PCNA_PYRAB DNA polymerase sliding clamp OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pcn PE=1 SV=1 2 257 1.0E-18
sp|B0KR83|PDXY_PSEPG Pyridoxamine kinase OS=Pseudomonas putida (strain GB-1) GN=pdxY PE=3 SV=1 285 605 1.0E-18
sp|P57762|PCNA1_SULOH DNA polymerase sliding clamp 1 OS=Sulfurisphaera ohwakuensis GN=pcn1 PE=3 SV=1 12 255 2.0E-18
sp|Q88C26|PDXY_PSEPK Pyridoxamine kinase OS=Pseudomonas putida (strain KT2440) GN=pdxY PE=3 SV=1 285 605 3.0E-18
sp|A6VNE5|PDXY_ACTSZ Pyridoxamine kinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pdxY PE=3 SV=1 285 453 4.0E-18
sp|B3H2H2|PDXY_ACTP7 Pyridoxamine kinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pdxY PE=3 SV=1 285 441 5.0E-18
sp|Q9CNY1|PDXY_PASMU Pyridoxamine kinase OS=Pasteurella multocida (strain Pm70) GN=pdxY PE=3 SV=1 285 441 7.0E-18
sp|C3K4G7|PDXY_PSEFS Pyridoxamine kinase OS=Pseudomonas fluorescens (strain SBW25) GN=pdxY PE=3 SV=1 285 607 8.0E-18
sp|Q65UE8|PDXY_MANSM Pyridoxamine kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pdxY PE=3 SV=1 285 452 1.0E-17
sp|O73947|PCNA_PYRFU DNA polymerase sliding clamp OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pcn PE=1 SV=2 2 257 1.0E-17
sp|A3N2D3|PDXY_ACTP2 Pyridoxamine kinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pdxY PE=3 SV=1 285 441 2.0E-17
sp|Q7MGA4|PDXY_VIBVY Pyridoxamine kinase OS=Vibrio vulnificus (strain YJ016) GN=pdxY PE=3 SV=1 285 440 2.0E-17
sp|Q48BL6|PDXY_PSE14 Pyridoxamine kinase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pdxY PE=3 SV=1 285 604 2.0E-17
sp|Q87TZ6|PDXY_PSESM Pyridoxamine kinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pdxY PE=3 SV=1 285 604 2.0E-17
sp|B1JFM7|PDXY_PSEPW Pyridoxamine kinase OS=Pseudomonas putida (strain W619) GN=pdxY PE=3 SV=1 285 605 3.0E-17
sp|Q8D4Q2|PDXY_VIBVU Pyridoxamine kinase OS=Vibrio vulnificus (strain CMCP6) GN=pdxY PE=3 SV=1 285 440 3.0E-17
sp|A5WB73|PDXY_PSEP1 Pyridoxamine kinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pdxY PE=3 SV=1 285 605 3.0E-17
sp|A5UA83|PDXY_HAEIE Pyridoxamine kinase OS=Haemophilus influenzae (strain PittEE) GN=pdxY PE=3 SV=1 285 441 3.0E-17
sp|Q2NE55|PCNA_METST DNA polymerase sliding clamp OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pcn PE=3 SV=1 1 180 3.0E-17
sp|Q87FP6|PDXY_VIBPA Pyridoxamine kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pdxY PE=3 SV=1 285 440 8.0E-17
sp|Q4K3F6|PDXY_PSEF5 Pyridoxamine kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pdxY PE=3 SV=1 285 607 8.0E-17
sp|P44690|PDXY_HAEIN Pyridoxamine kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pdxY PE=3 SV=1 285 441 1.0E-16
sp|Q6LP62|PDXY_PHOPR Pyridoxamine kinase OS=Photobacterium profundum GN=pdxY PE=3 SV=1 285 440 1.0E-16
sp|Q8TWK3|PCNA_METKA DNA polymerase sliding clamp OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pcn PE=3 SV=1 4 255 1.0E-16
sp|Q9UWR9|PCNA_THEFM DNA polymerase sliding clamp OS=Thermococcus fumicolans GN=pcn PE=3 SV=1 15 256 1.0E-16
sp|A1RXU8|PCNA_THEPD DNA polymerase sliding clamp OS=Thermofilum pendens (strain Hrk 5) GN=pcn PE=3 SV=1 13 255 1.0E-16
sp|Q4JAI6|PCNA1_SULAC DNA polymerase sliding clamp 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pcn1 PE=3 SV=2 12 255 2.0E-16
sp|Q975N2|PCNA1_SULTO DNA polymerase sliding clamp 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pcn1 PE=1 SV=1 12 255 2.0E-16
sp|C5A5N6|PCNA_THEGJ DNA polymerase sliding clamp OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pcn PE=3 SV=1 15 257 3.0E-16
sp|A7N5Q6|PDXY_VIBCB Pyridoxamine kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pdxY PE=3 SV=1 285 440 4.0E-16
sp|P57765|PCNA3_SULSO DNA polymerase sliding clamp 3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pcn3 PE=1 SV=1 11 255 6.0E-16
sp|B9LU30|PCNA_HALLT DNA polymerase sliding clamp OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pcn PE=3 SV=1 9 256 8.0E-16
sp|Q5JF32|PCNA1_THEKO DNA polymerase sliding clamp 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pcn1 PE=1 SV=1 15 255 1.0E-15
sp|Q1LFU5|PDXK_CUPMC Pyridoxine kinase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pdxK PE=3 SV=1 285 513 2.0E-15
sp|A0B7Y8|PCNA_METTP DNA polymerase sliding clamp OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pcn PE=3 SV=1 1 257 3.0E-15
sp|Q4ZL75|PDXY_PSEU2 Pyridoxamine kinase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pdxY PE=3 SV=1 285 604 3.0E-15
sp|Q1CIM6|PDXY_YERPN Pyridoxamine kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pdxY PE=3 SV=1 285 425 3.0E-15
sp|Q7CIR8|PDXY_YERPE Pyridoxamine kinase OS=Yersinia pestis GN=pdxY PE=1 SV=1 285 425 3.0E-15
sp|Q1C792|PDXY_YERPA Pyridoxamine kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pdxY PE=3 SV=1 285 425 3.0E-15
sp|Q66A50|PDXY_YERPS Pyridoxamine kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pdxY PE=3 SV=1 285 425 3.0E-15
sp|Q3IU15|PCNA_NATPD DNA polymerase sliding clamp OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pcn PE=3 SV=1 9 256 6.0E-15
sp|Q62LP6|PDXY_BURMA Pyridoxamine kinase OS=Burkholderia mallei (strain ATCC 23344) GN=pdxY PE=3 SV=1 285 604 8.0E-15
sp|Q74MV1|PCNA_NANEQ DNA polymerase sliding clamp OS=Nanoarchaeum equitans (strain Kin4-M) GN=pcn PE=3 SV=2 9 254 1.0E-14
sp|Q9YEZ5|PCNA3_AERPE DNA polymerase sliding clamp 3 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pcn3 PE=3 SV=2 9 255 1.0E-14
sp|A6VEZ4|PDXY_PSEA7 Pyridoxamine kinase OS=Pseudomonas aeruginosa (strain PA7) GN=pdxY PE=3 SV=1 285 604 1.0E-14
sp|Q02DJ3|PDXY_PSEAB Pyridoxamine kinase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pdxY PE=3 SV=1 285 604 1.0E-14
sp|Q63SC2|PDXY_BURPS Pyridoxamine kinase OS=Burkholderia pseudomallei (strain K96243) GN=pdxY PE=3 SV=1 285 604 1.0E-14
sp|Q8Z6Q3|PDXY_SALTI Putative pyridoxamine kinase OS=Salmonella typhi GN=pdxY PE=5 SV=1 285 441 2.0E-14
sp|Q3JQA6|PDXY_BURP1 Pyridoxamine kinase OS=Burkholderia pseudomallei (strain 1710b) GN=pdxY PE=3 SV=2 285 604 3.0E-14
sp|Q7N3W7|PDXY_PHOLL Pyridoxamine kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pdxY PE=3 SV=1 285 444 3.0E-14
sp|Q9HT57|PDXY_PSEAE Pyridoxamine kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pdxY PE=3 SV=1 285 604 4.0E-14
sp|Q5PIK8|PDXY_SALPA Pyridoxamine kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pdxY PE=3 SV=1 285 428 5.0E-14
sp|Q8ZPM8|PDXY_SALTY Pyridoxamine kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pdxY PE=3 SV=1 285 428 5.0E-14
sp|Q57PI7|PDXY_SALCH Pyridoxamine kinase OS=Salmonella choleraesuis (strain SC-B67) GN=pdxY PE=3 SV=1 285 428 5.0E-14
sp|Q9HN45|PCNA_HALSA DNA polymerase sliding clamp OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pcn PE=3 SV=1 9 256 5.0E-14
sp|B0R7F7|PCNA_HALS3 DNA polymerase sliding clamp OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pcn PE=3 SV=1 9 256 5.0E-14
sp|Q141E8|PDXY_BURXL Pyridoxamine kinase OS=Burkholderia xenovorans (strain LB400) GN=pdxY PE=3 SV=1 285 458 7.0E-14
sp|Q5PNC8|PDXK_SALPA Pyridoxine kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pdxK PE=3 SV=1 286 503 8.0E-14
sp|B7V753|PDXY_PSEA8 Pyridoxamine kinase OS=Pseudomonas aeruginosa (strain LESB58) GN=pdxY PE=3 SV=1 285 607 9.0E-14
sp|P40192|PDXK_SALTY Pyridoxine kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pdxK PE=3 SV=2 286 503 1.0E-13
sp|Q57LS3|PDXK_SALCH Pyridoxine kinase OS=Salmonella choleraesuis (strain SC-B67) GN=pdxK PE=3 SV=1 286 503 1.0E-13
sp|Q6D5V1|PDXY_PECAS Pyridoxamine kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pdxY PE=3 SV=1 285 604 1.0E-13
sp|Q2SXQ4|PDXY_BURTA Pyridoxamine kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pdxY PE=3 SV=2 285 604 1.0E-13
sp|Q973F5|PCNA3_SULTO DNA polymerase sliding clamp 3 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pcn3 PE=1 SV=1 9 254 2.0E-13
sp|Q83KY1|PDXY_SHIFL Pyridoxamine kinase OS=Shigella flexneri GN=pdxY PE=3 SV=3 285 423 3.0E-13
sp|Q320Z3|PDXY_SHIBS Pyridoxamine kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=pdxY PE=3 SV=3 285 423 3.0E-13
sp|P77150|PDXY_ECOLI Pyridoxamine kinase OS=Escherichia coli (strain K12) GN=pdxY PE=1 SV=3 285 423 3.0E-13
sp|Q1RBF9|PDXY_ECOUT Pyridoxamine kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=pdxY PE=3 SV=3 285 423 3.0E-13
sp|Q8FH89|PDXY_ECOL6 Pyridoxamine kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pdxY PE=3 SV=3 285 423 3.0E-13
sp|Q0THJ1|PDXY_ECOL5 Pyridoxamine kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pdxY PE=3 SV=2 285 423 3.0E-13
sp|Q8X649|PDXY_ECO57 Pyridoxamine kinase OS=Escherichia coli O157:H7 GN=pdxY PE=3 SV=3 285 423 3.0E-13
sp|Q5JFD3|PCNA2_THEKO DNA polymerase sliding clamp 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pcn2 PE=1 SV=1 2 255 3.0E-13
sp|Q3Z1Z2|PDXY_SHISS Pyridoxamine kinase OS=Shigella sonnei (strain Ss046) GN=pdxY PE=3 SV=3 285 423 3.0E-13
sp|O29912|PCNA_ARCFU DNA polymerase sliding clamp OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pcn PE=1 SV=1 9 255 4.0E-13
sp|Q39I40|PDXY_BURL3 Pyridoxamine kinase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pdxY PE=3 SV=2 285 604 4.0E-13
sp|Q18E60|PCNA_HALWD DNA polymerase sliding clamp OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pcn PE=3 SV=1 9 256 5.0E-13
sp|Q7T6Y0|PCNA_MIMIV Probable DNA polymerase sliding clamp OS=Acanthamoeba polyphaga mimivirus GN=PCNA PE=3 SV=2 31 253 6.0E-13
sp|Q9P9H8|PCNA_HALMA DNA polymerase sliding clamp OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pcn PE=3 SV=2 9 256 6.0E-13
sp|Q1BXQ7|PDXY_BURCA Pyridoxamine kinase OS=Burkholderia cenocepacia (strain AU 1054) GN=pdxY PE=3 SV=1 285 604 9.0E-13
sp|Q32FD7|PDXY_SHIDS Pyridoxamine kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pdxY PE=3 SV=3 285 423 1.0E-12
sp|Q5E345|PDXY_VIBF1 Pyridoxamine kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pdxY PE=3 SV=1 287 428 1.0E-12
sp|B6YVZ1|PCNA_THEON DNA polymerase sliding clamp OS=Thermococcus onnurineus (strain NA1) GN=pcn PE=3 SV=1 15 256 1.0E-12
sp|Q8Z4W1|PDXK_SALTI Pyridoxine kinase OS=Salmonella typhi GN=pdxK PE=3 SV=1 286 503 2.0E-12
sp|Q46E39|PCNA_METBF DNA polymerase sliding clamp OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pcn PE=3 SV=1 8 256 3.0E-12
sp|B2JCI0|PDXY_BURP8 Pyridoxamine kinase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pdxY PE=3 SV=1 285 458 8.0E-12
sp|B7N609|PDXK_ECOLU Pyridoxine kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pdxK PE=3 SV=1 286 503 9.0E-12
sp|Q32DD5|PDXK_SHIDS Pyridoxine kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pdxK PE=3 SV=1 286 503 1.0E-11
sp|Q97Z84|PCNA2_SULSO DNA polymerase sliding clamp 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pcn2 PE=1 SV=2 2 254 1.0E-11
sp|B7NPV5|PDXK_ECO7I Pyridoxine kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pdxK PE=3 SV=1 286 503 1.0E-11
sp|P40191|PDXK_ECOLI Pyridoxine kinase OS=Escherichia coli (strain K12) GN=pdxK PE=1 SV=2 286 503 2.0E-11
sp|B1IX53|PDXK_ECOLC Pyridoxine kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|A8A2R4|PDXK_ECOHS Pyridoxine kinase OS=Escherichia coli O9:H4 (strain HS) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|B1XA89|PDXK_ECODH Pyridoxine kinase OS=Escherichia coli (strain K12 / DH10B) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|C4ZVU9|PDXK_ECOBW Pyridoxine kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|Q3YZC3|PDXK_SHISS Pyridoxine kinase OS=Shigella sonnei (strain Ss046) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|B6I4Z5|PDXK_ECOSE Pyridoxine kinase OS=Escherichia coli (strain SE11) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|B7M6S8|PDXK_ECO8A Pyridoxine kinase OS=Escherichia coli O8 (strain IAI1) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|B7UGB9|PDXK_ECO27 Pyridoxine kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|A7ZPL9|PDXK_ECO24 Pyridoxine kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|B5YZW5|PDXK_ECO5E Pyridoxine kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|Q8XBL0|PDXK_ECO57 Pyridoxine kinase OS=Escherichia coli O157:H7 GN=pdxK PE=3 SV=3 286 503 2.0E-11
sp|C6A1Y5|PCNA_THESM DNA polymerase sliding clamp OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=pcn PE=3 SV=1 15 255 2.0E-11
sp|B7LL66|PDXK_ESCF3 Pyridoxine kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|B2TX08|PDXK_SHIB3 Pyridoxine kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|Q83K78|PDXK_SHIFL Pyridoxine kinase OS=Shigella flexneri GN=pdxK PE=3 SV=1 286 503 2.0E-11
sp|B7LCG3|PDXK_ECO55 Pyridoxine kinase OS=Escherichia coli (strain 55989 / EAEC) GN=pdxK PE=3 SV=1 286 503 3.0E-11
sp|Q1R8V2|PDXK_ECOUT Pyridoxine kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=pdxK PE=3 SV=1 286 503 3.0E-11
sp|Q8FFB5|PDXK_ECOL6 Pyridoxine kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pdxK PE=3 SV=1 286 503 3.0E-11
sp|Q0TF48|PDXK_ECOL5 Pyridoxine kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pdxK PE=3 SV=1 286 503 3.0E-11
sp|A1ADT5|PDXK_ECOK1 Pyridoxine kinase OS=Escherichia coli O1:K1 / APEC GN=pdxK PE=3 SV=1 286 503 3.0E-11
sp|B7MY71|PDXK_ECO81 Pyridoxine kinase OS=Escherichia coli O81 (strain ED1a) GN=pdxK PE=3 SV=1 286 503 3.0E-11
sp|B7MHS2|PDXK_ECO45 Pyridoxine kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pdxK PE=3 SV=1 286 503 3.0E-11
sp|Q8PX25|PCNA_METMA DNA polymerase sliding clamp OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pcn PE=3 SV=1 8 256 5.0E-11
sp|B1LML3|PDXK_ECOSM Pyridoxine kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pdxK PE=3 SV=1 286 503 9.0E-11
sp|Q51892|PDXY_PROMI Pyridoxamine kinase OS=Proteus mirabilis GN=pdxY PE=3 SV=2 285 425 9.0E-11
sp|Q9YFT8|PCNA1_AERPE DNA polymerase sliding clamp 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pcn1 PE=3 SV=2 8 253 9.0E-11
sp|Q8TUF7|PCNA_METAC DNA polymerase sliding clamp OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pcn PE=3 SV=1 8 256 2.0E-10
sp|Q7VYK4|PDXK_BORPE Pyridoxine kinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pdxK PE=3 SV=2 286 559 2.0E-10
sp|Q7W6K7|PDXK_BORPA Pyridoxine kinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pdxK PE=3 SV=2 286 559 3.0E-10
sp|Q7WII1|PDXK_BORBR Pyridoxine kinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pdxK PE=3 SV=2 286 559 3.0E-10
sp|Q2FNX1|PCNA_METHJ DNA polymerase sliding clamp OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pcn PE=3 SV=1 1 256 3.0E-10
sp|Q4J9A8|PCNA2_SULAC DNA polymerase sliding clamp 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pcn2 PE=3 SV=1 15 254 5.0E-10
sp|Q9HJQ0|PCNA_THEAC DNA polymerase sliding clamp OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pcn PE=3 SV=1 12 257 8.0E-10
sp|Q979S2|PCNA_THEVO DNA polymerase sliding clamp OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pcn PE=3 SV=2 12 257 9.0E-10
sp|A7I849|PCNA_METB6 DNA polymerase sliding clamp OS=Methanoregula boonei (strain 6A8) GN=pcn PE=3 SV=1 1 256 2.0E-09
sp|Q12U18|PCNA_METBU DNA polymerase sliding clamp OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pcn PE=3 SV=1 1 256 2.0E-09
sp|Q2L1P5|PDXK_BORA1 Pyridoxine kinase OS=Bordetella avium (strain 197N) GN=pdxK PE=3 SV=1 285 503 6.0E-09
sp|Q6KZF1|PCNA_PICTO DNA polymerase sliding clamp OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pcn PE=3 SV=1 12 256 3.0E-08
sp|B8GG80|PCNA_METPE DNA polymerase sliding clamp OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pcn PE=3 SV=1 1 256 3.0E-07
sp|A3CVJ2|PCNA_METMJ DNA polymerase sliding clamp OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pcn PE=3 SV=1 1 255 5.0E-07
sp|Q975M2|PCNA2_SULTO DNA polymerase sliding clamp 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pcn2 PE=1 SV=1 1 255 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006275 regulation of DNA replication Yes
GO:0003677 DNA binding Yes
GO:0065007 biological regulation No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0008150 biological_process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0003674 molecular_function No
GO:0031323 regulation of cellular metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0051052 regulation of DNA metabolic process No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup328
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1774
Ophiocordyceps australis 1348a (Ghana) OphauG2|2226
Ophiocordyceps australis map64 (Brazil) OphauB2|5589
Ophiocordyceps australis map64 (Brazil) OphauB2|5590
Ophiocordyceps camponoti-floridani Ophcf2|07285
Ophiocordyceps camponoti-floridani Ophcf2|07286
Ophiocordyceps camponoti-rufipedis Ophun1|278 (this protein)
Ophiocordyceps kimflemingae Ophio5|1931
Ophiocordyceps subramaniannii Hirsu2|345
Ophiocordyceps subramaniannii Hirsu2|346

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|278
MLEARLEQANILKKLVDSIKDLVQDCNFDCNDSGIALQAMDNSHVALVSMMLKAEGFSPYRCDRNIPLGVNLASL
TKVLRAAQNEDILTLKAQDAPDVLNLVFESSENDRISEYDLKLMDIDQEHLGIPDTEYAASITMPAAEFRRICTD
LAAMSESVSIEASKDGIKFACNGDIGNGSVVLRSHTNVDKPELNVDIELTDPVSLTFSLKYLVNFCKASSLSNTV
KLCLSSEVPLLVEYNLSGSSYLRFYLAPKVRRLMGDERDSFLGRQNPVQVRRCNRMEKCYVGNKVAVLVLQSLGC
DVAALNTVQFSNHTGYGQWTGKAVAADAVADLWAGLKQNSLDDLDMMLSGYMPGADVVAAVGAIAKELKEKDGQG
PDRFFWVLDPVMGDNGSLYVADDVVPAYKALVPCADLILPNQFEANLLSGVSIVDMTSLTAAIQALHDRYRVPHV
VITSVRLDGPHQPDGHLAVVGSSMKSDGKARLFRLVFPRIDAYFSGTGDMFGALVCVRMREAVAAVPGLSARPSW
LSDDEVSARELPLARATEKVLASMHEVLSRTRDAMPAVVERVRRRAGEEGARCVESRAAELQLVQSLDCLRNPTV
RFEAEAV*
Coding >Ophun1|278
ATGTTGGAGGCACGACTCGAACAGGCTAACATCCTCAAAAAGTTGGTGGACTCTATCAAGGACCTCGTTCAGGAC
TGCAACTTCGACTGCAATGATTCGGGCATCGCGCTCCAGGCCATGGACAACTCGCACGTCGCCCTCGTGTCCATG
ATGCTCAAGGCCGAGGGCTTCTCGCCCTACCGGTGCGACCGCAACATCCCGCTGGGCGTCAACCTCGCGTCTCTG
ACAAAGGTGCTGCGGGCGGCGCAAAACGAGGATATCCTGACGCTCAAGGCGCAGGACGCGCCCGACGTGCTCAAC
CTGGTCTTTGAGAGCAGCGAGAACGACCGGATCAGCGAGTACGACTTGAAGCTCATGGACATTGATCAGGAGCAT
CTGGGCATTCCCGATACGGAGTATGCGGCGTCGATTACGATGCCGGCGGCAGAGTTCCGGAGAATCTGCACTGAC
CTGGCAGCCATGTCGGAGTCAGTGAGCATCGAGGCAAGCAAGGACGGCATCAAGTTTGCGTGCAACGGCGACATT
GGCAACGGCTCCGTCGTTCTCCGGAGTCACACCAACGTCGACAAGCCCGAGCTCAACGTCGACATTGAGCTGACG
GACCCTGTCTCGCTGACGTTTTCGCTCAAATATCTTGTCAATTTCTGCAAGGCTTCTTCTCTCTCCAACACGGTC
AAGCTGTGCCTGTCGAGCGAGGTGCCGCTGCTGGTGGAGTACAACCTGTCGGGCAGCAGCTACTTGCGCTTCTAC
TTGGCGCCCAAGGTTCGTCGACTGATGGGTGATGAGAGGGACTCGTTTCTCGGTCGTCAGAACCCCGTCCAAGTG
AGGCGTTGTAACAGGATGGAGAAATGCTACGTCGGCAACAAGGTGGCCGTGCTCGTGCTGCAATCGCTAGGATGC
GATGTGGCCGCGCTCAACACGGTCCAGTTCAGTAATCACACCGGATATGGGCAGTGGACGGGCAAGGCTGTCGCG
GCCGATGCCGTGGCCGACTTGTGGGCTGGGCTGAAGCAGAATTCCCTCGATGACTTGGACATGATGCTTTCTGGC
TACATGCCTGGCGCCGACGTCGTGGCCGCTGTAGGAGCCATTGCCAAGGAGCTCAAGGAGAAGGATGGGCAGGGT
CCTGATCGCTTCTTCTGGGTGCTGGATCCCGTCATGGGTGACAATGGTAGCCTCTACGTTGCTGATGACGTCGTG
CCGGCTTACAAGGCGCTCGTGCCCTGCGCCGACCTGATCCTACCCAACCAGTTCGAGGCCAATCTGCTGTCTGGC
GTCTCCATCGTCGACATGACGAGCCTAACAGCCGCCATCCAAGCGCTGCATGACCGATACCGCGTCCCGCACGTC
GTCATCACCTCAGTCCGGCTCGACGGACCGCACCAGCCGGACGGTCATCTGGCCGTGGTGGGCTCTAGCATGAAG
TCGGACGGCAAGGCGCGTCTCTTCAGGCTCGTCTTCCCACGCATCGACGCATACTTCTCCGGCACGGGCGACATG
TTTGGCGCCCTCGTCTGCGTTCGCATGCGCGAGGCTGTCGCTGCTGTGCCGGGTCTGAGCGCGAGGCCAAGCTGG
TTGAGCGATGATGAGGTGTCTGCGAGGGAGCTGCCGTTGGCTAGGGCCACGGAGAAGGTCTTGGCCAGCATGCAC
GAAGTTCTCTCCCGCACTCGCGATGCTATGCCTGCTGTTGTTGAGAGGGTTAGGCGGAGGGCGGGAGAGGAGGGT
GCGCGGTGTGTCGAGTCCAGGGCTGCTGAGTTGCAGTTGGTGCAGAGCCTGGACTGTTTGCGGAATCCGACGGTG
CGGTTTGAGGCTGAGGCTGTCTAG
Transcript >Ophun1|278
ATGTTGGAGGCACGACTCGAACAGGCTAACATCCTCAAAAAGTTGGTGGACTCTATCAAGGACCTCGTTCAGGAC
TGCAACTTCGACTGCAATGATTCGGGCATCGCGCTCCAGGCCATGGACAACTCGCACGTCGCCCTCGTGTCCATG
ATGCTCAAGGCCGAGGGCTTCTCGCCCTACCGGTGCGACCGCAACATCCCGCTGGGCGTCAACCTCGCGTCTCTG
ACAAAGGTGCTGCGGGCGGCGCAAAACGAGGATATCCTGACGCTCAAGGCGCAGGACGCGCCCGACGTGCTCAAC
CTGGTCTTTGAGAGCAGCGAGAACGACCGGATCAGCGAGTACGACTTGAAGCTCATGGACATTGATCAGGAGCAT
CTGGGCATTCCCGATACGGAGTATGCGGCGTCGATTACGATGCCGGCGGCAGAGTTCCGGAGAATCTGCACTGAC
CTGGCAGCCATGTCGGAGTCAGTGAGCATCGAGGCAAGCAAGGACGGCATCAAGTTTGCGTGCAACGGCGACATT
GGCAACGGCTCCGTCGTTCTCCGGAGTCACACCAACGTCGACAAGCCCGAGCTCAACGTCGACATTGAGCTGACG
GACCCTGTCTCGCTGACGTTTTCGCTCAAATATCTTGTCAATTTCTGCAAGGCTTCTTCTCTCTCCAACACGGTC
AAGCTGTGCCTGTCGAGCGAGGTGCCGCTGCTGGTGGAGTACAACCTGTCGGGCAGCAGCTACTTGCGCTTCTAC
TTGGCGCCCAAGGTTCGTCGACTGATGGGTGATGAGAGGGACTCGTTTCTCGGTCGTCAGAACCCCGTCCAAGTG
AGGCGTTGTAACAGGATGGAGAAATGCTACGTCGGCAACAAGGTGGCCGTGCTCGTGCTGCAATCGCTAGGATGC
GATGTGGCCGCGCTCAACACGGTCCAGTTCAGTAATCACACCGGATATGGGCAGTGGACGGGCAAGGCTGTCGCG
GCCGATGCCGTGGCCGACTTGTGGGCTGGGCTGAAGCAGAATTCCCTCGATGACTTGGACATGATGCTTTCTGGC
TACATGCCTGGCGCCGACGTCGTGGCCGCTGTAGGAGCCATTGCCAAGGAGCTCAAGGAGAAGGATGGGCAGGGT
CCTGATCGCTTCTTCTGGGTGCTGGATCCCGTCATGGGTGACAATGGTAGCCTCTACGTTGCTGATGACGTCGTG
CCGGCTTACAAGGCGCTCGTGCCCTGCGCCGACCTGATCCTACCCAACCAGTTCGAGGCCAATCTGCTGTCTGGC
GTCTCCATCGTCGACATGACGAGCCTAACAGCCGCCATCCAAGCGCTGCATGACCGATACCGCGTCCCGCACGTC
GTCATCACCTCAGTCCGGCTCGACGGACCGCACCAGCCGGACGGTCATCTGGCCGTGGTGGGCTCTAGCATGAAG
TCGGACGGCAAGGCGCGTCTCTTCAGGCTCGTCTTCCCACGCATCGACGCATACTTCTCCGGCACGGGCGACATG
TTTGGCGCCCTCGTCTGCGTTCGCATGCGCGAGGCTGTCGCTGCTGTGCCGGGTCTGAGCGCGAGGCCAAGCTGG
TTGAGCGATGATGAGGTGTCTGCGAGGGAGCTGCCGTTGGCTAGGGCCACGGAGAAGGTCTTGGCCAGCATGCAC
GAAGTTCTCTCCCGCACTCGCGATGCTATGCCTGCTGTTGTTGAGAGGGTTAGGCGGAGGGCGGGAGAGGAGGGT
GCGCGGTGTGTCGAGTCCAGGGCTGCTGAGTTGCAGTTGGTGCAGAGCCTGGACTGTTTGCGGAATCCGACGGTG
CGGTTTGAGGCTGAGGCTGTCTAG
Gene >Ophun1|278
ATGTTGGAGGCACGACTCGAACAGGCTAACATCCTCAAAAAGGTGATTTCCCTCTGCCTCGCTCATAGCTCGCGC
GGCCGCTGACAGATGACCAGTTGGTGGACTCTATCAAGGACCTCGTTCAGGACTGCAACTTCGACTGCAATGATT
CGGGCATCGCGCTCCAGGCCATGGACAACTCGCACGTCGCCCTCGTGTCCATGATGCTCAAGGCCGAGGGCTTCT
CGCCCTACCGGTGCGACCGCAACATCCCGCTGGGCGTCAACCTCGCGTCTCTGACAAAGGTGCTGCGGGCGGCGC
AAAACGAGGATATCCTGACGCTCAAGGCGCAGGACGCGCCCGACGTGCTCAACCTGGTCTTTGAGAGCAGCGAGA
ACGACCGGATCAGCGAGTACGACTTGAAGCTCATGGACATTGATCAGGAGCATCTGGGCATTCCCGATACGGAGT
ATGCGGCGTCGATTACGATGCCGGCGGCAGAGTTCCGGAGAATCTGCACTGACCTGGCAGCCATGTCGGAGTCAG
GTACGACTGCGCGAGACGAAGTGCTGATGACGGATGGCTGACTCTTTGTTATAGTGAGCATCGAGGCAAGCAAGG
ACGGCATCAAGTTTGCGTGCAACGGCGACATTGGCAACGGCTCCGTCGTTCTCCGGAGTCACACCAACGTCGACA
AGCCCGAGCTCAACGTCGACATTGAGCTGACGGACCCTGTCTCGCTGACGTTTTCGCTCAAATATCTTGTCAATT
TCTGCAAGGCTTCTTCTCTCTCCAACACGGTCAAGCTGTGCCTGTCGAGCGAGGTGCCGCTGCTGGTGGAGTACA
ACCTGTCGGGCAGCAGCTACTTGCGCTTCTACTTGGCGCCCAAGGTTCGTCGACTGATGGTATGGTTGGTGTGTA
CGAGTCGCTAACAGCTGGCAGATCGGTGACGAAGAGTAGGGTGATGAGAGGGACTCGTTTCTCGGTCGTCAGAAC
CCCGTCCAAGTGAGGCGTTGTAACAGGATGGAGAAATGGTGAGCCTCGATGTTGTCTGTAGCTACGTGGGTAAAT
AAATAAAGGCCGGGGCATTCGGACACAACTCAAATCCTATCATGTATGAATATCGCAGCTTTTCTTGGACTTCTG
GTGACGACCTGCGACGGGTAGTGAAGCCGGTAGCGGGGACGCTTGGTGTCGACTTATGTCATGGACCCGAGTTCG
CTGACTCCAACCCTGGAGGAGTGGTTTTCAGGCAGCTCGACTTCTCAACTTGGCCTGCCGTCATCAAAATCCCTT
GTGCGACGGCCCCTGAATTGAAAGCCCCTGATACAACGACCCTTGAATCGACGGTTCCTGCTTCAGCATTCCCCA
TCATCCCGCTGTGATGGCGCCCGAGCTGCCACCACGGATCCTGGCCGTCGCCAGCCATGTATGTGCCTCCTCTGT
GGAAGACTTCATGGTCTCGACTGAGCGTGTGCCTGCAGGTCGTATCGGGGTAATATACGAATATTGCCGCTGTCT
GGGTCGGCTATCGGCTGACCTTCAGAAGCTACGTCGGCAACAAGGTGGCCGTGCTCGTGCTGCAATCGCTAGGAT
GCGATGTGGCCGCGCTCAACACGGTCCAGTTCAGTGAGCAGAGAGACGTAAAGAAGTCTTTCGGTCGGTTGCTGA
CGTCGTGGCAGGTAATCACACCGGATATGGGCAGTGGACGGGCAAGGCTGTCGCGGCCGATGCCGTGGCCGACTT
GTGGGCTGGGCTGAAGCAGAATTCCCTCGATGACTTGGACATGATGCTTTCTGGCTACATGCCTGGCGCCGACGT
CGTGGCCGCTGTAGGAGCCATTGCCAAGGAGCTCAAGGAGAAGGATGGGCAGGGTCCTGATCGCTTCTTCTGGGT
GCTGGATCCCGTCATGGGTGACAATGGTAGCCTCTACGTTGCTGATGACGTCGTGCCGGCTTACAAGGCGCTCGT
GCCCTGCGCCGACCTGATCCTACCCAACCAGTTCGAGGCCAAGTACGGCGTGCTCCCGTCGTCTGTCTTATGAGG
CTTCGCTAACGGGGAAAAGTCTGCTGTCTGGCGTCTCCATCGTCGACATGACGAGCCTAACAGCCGCCATCCAAG
CGCTGCATGACCGATACCGCGTCCCGCACGTCGTCATCACCTCAGTCCGGCTCGACGGACCGCACCAGCCGGACG
GTCATCTGGCCGTGGTGGGCTCTAGCATGAAGTCGGACGGCAAGGCGCGTCTCTTCAGGCTCGTCTTCCCACGCA
TCGACGCATACTTCTCCGGCACGGGCGACATGTTTGGCGCCCTCGTCTGCGTTCGCATGCGCGAGGCTGTCGCTG
CTGTGCCGGGTCTGAGCGCGAGGCCAAGCTGGTTGAGCGATGATGAGGTGTCTGCGAGGGAGCTGCCGTTGGCTA
GGGCCACGGAGAAGGTCTTGGCCAGCATGCACGAAGTTCTCTCCCGCACTCGCGATGCTATGCCTGCTGTTGTTG
AGAGGGTTAGGCGGAGGGCGGGAGAGGAGGGTGCGCGGTGTGTCGAGTCCAGGGCTGCTGAGTTGCAGTTGGTGC
AGAGCCTGGACTGTTTGCGGAATCCGACGGTGCGGTTTGAGGCTGAGGCTGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail