Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2777
Gene name
LocationContig_248:8159..10618
Strand-
Gene length (bp)2459
Transcript length (bp)2391
Coding sequence length (bp)2391
Protein length (aa) 797

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 9.4E-12 660 704
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 3.9E-09 660 703
PF02225 PA PA domain 8.6E-09 197 273
PF12678 zf-rbx1 RING-H2 zinc finger domain 1.1E-08 661 704
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.3E-08 661 703
PF17123 zf-RING_11 RING-like zinc finger 1.2E-08 660 689
PF13445 zf-RING_UBOX RING-type zinc-finger 4.3E-05 661 701

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 661 710 4.0E-11
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 661 710 5.0E-11
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 661 710 1.0E-10
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 661 710 1.0E-10
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 661 710 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 661 710 4.0E-11
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 661 710 5.0E-11
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 661 710 1.0E-10
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 661 710 1.0E-10
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 661 710 1.0E-10
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 661 710 2.0E-10
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 661 709 3.0E-10
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 661 709 3.0E-10
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 661 709 4.0E-10
sp|P87139|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1 659 707 3.0E-09
sp|O00237|RN103_HUMAN E3 ubiquitin-protein ligase RNF103 OS=Homo sapiens GN=RNF103 PE=1 SV=1 655 704 4.0E-09
sp|O64763|ATL9_ARATH E3 ubiquitin-protein ligase ATL9 OS=Arabidopsis thaliana GN=ATL9 PE=1 SV=1 659 753 6.0E-09
sp|Q9EPZ8|RN103_RAT E3 ubiquitin-protein ligase RNF103 OS=Rattus norvegicus GN=Rnf103 PE=2 SV=1 660 704 6.0E-09
sp|Q9R1W3|RN103_MOUSE E3 ubiquitin-protein ligase RNF103 OS=Mus musculus GN=Rnf103 PE=2 SV=2 660 704 6.0E-09
sp|Q9M0R7|ATL39_ARATH RING-H2 finger protein ATL39 OS=Arabidopsis thaliana GN=ATL39 PE=2 SV=1 658 708 1.0E-08
sp|Q7XTV7|HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica GN=HIP1 PE=1 SV=2 651 710 1.0E-08
sp|Q8GUU2|RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana GN=RIE1 PE=2 SV=1 588 709 1.0E-08
sp|Q9ZQF9|MBR1_ARATH E3 ubiquitin-protein ligase MBR1 OS=Arabidopsis thaliana GN=MBR1 PE=1 SV=1 661 710 1.0E-08
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 652 704 3.0E-08
sp|Q6IRP0|R126B_XENLA E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 652 704 4.0E-08
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 661 706 4.0E-08
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 661 706 5.0E-08
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 661 786 5.0E-08
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 661 717 6.0E-08
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 661 719 7.0E-08
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 660 722 8.0E-08
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 661 710 9.0E-08
sp|Q7T0Q3|R126A_XENLA E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 652 704 9.0E-08
sp|Q8RXD3|AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana GN=AIP2 PE=1 SV=1 647 707 1.0E-07
sp|Q4R6Y5|ZNRF4_MACFA Zinc/RING finger protein 4 OS=Macaca fascicularis GN=ZNRF4 PE=2 SV=1 649 707 1.0E-07
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 661 711 1.0E-07
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 661 706 1.0E-07
sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 660 710 1.0E-07
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 661 711 2.0E-07
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 661 710 2.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 660 710 2.0E-07
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 646 706 3.0E-07
sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 661 711 3.0E-07
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 660 711 3.0E-07
sp|Q1MTR5|YG66_SCHPO Uncharacterized RING finger membrane protein C15C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.06c PE=3 SV=1 658 718 3.0E-07
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 659 706 3.0E-07
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 178 320 3.0E-07
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 659 707 4.0E-07
sp|Q8WWF5|ZNRF4_HUMAN Zinc/RING finger protein 4 OS=Homo sapiens GN=ZNRF4 PE=2 SV=3 649 707 5.0E-07
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 656 709 5.0E-07
sp|Q8GXF8|SHGR9_ARATH E3 ubiquitin-protein ligase SGR9, amyloplastic OS=Arabidopsis thaliana GN=SGR9 PE=1 SV=1 658 707 5.0E-07
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 654 706 6.0E-07
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 654 706 7.0E-07
sp|Q9M0R6|ATL35_ARATH Putative RING-H2 finger protein ATL35 OS=Arabidopsis thaliana GN=ATL35 PE=3 SV=1 659 707 7.0E-07
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 661 707 7.0E-07
sp|Q9LUL6|ATL61_ARATH Putative RING-H2 finger protein ATL61 OS=Arabidopsis thaliana GN=ATL61 PE=3 SV=1 659 729 7.0E-07
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 661 708 8.0E-07
sp|P87119|MU145_SCHPO RING finger protein mug145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug145 PE=1 SV=1 661 713 8.0E-07
sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 650 704 9.0E-07
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 661 739 1.0E-06
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 660 709 1.0E-06
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 661 739 1.0E-06
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 661 708 1.0E-06
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 653 706 1.0E-06
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 652 704 1.0E-06
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 652 704 2.0E-06
sp|Q08D68|ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis GN=znrf3 PE=1 SV=1 661 709 2.0E-06
sp|Q9M0R4|ATL37_ARATH Putative RING-H2 finger protein ATL37 OS=Arabidopsis thaliana GN=ATL37 PE=3 SV=1 659 707 2.0E-06
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 660 710 3.0E-06
sp|Q9M0R5|ATL36_ARATH Putative RING-H2 finger protein ATL36 OS=Arabidopsis thaliana GN=ATL36 PE=3 SV=1 659 782 4.0E-06
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 659 724 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 524 546 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2777
MRPPRIAVLALFLAASIFILGRAFTPSSRPHASSSYPSEARSSRSVFGFVYYNTPFSLFPPNAAISLTDDNSTSF
AARPAAFGPKLAALGLSGQLWVGSGFAEDSQDGDGELGCSDLPGWGTGNIRAGLRSSFRADMSKPSSSSSSSSSS
SSAHLLDPDHVIAAKARPARRVHARSSLSRRDSSSSSSTSSSSAHADIQSIQEAAEIQGKVVLLMRGGCGFLEKV
MWAQRRGAIAVIVGDNQKGGPLIQMFAHGDEVENVTVPSVFTARTTAHLLSSLTQPGSFIEDTLDDSGNPVRKVQ
QGPKKSDGKTRTLKPAASPPAGSPKSKARRALRPASSDPAANRGWLSRLFGWRQAPLVAVDKSRPPSSGRRDWVL
VDSWSDDSDKVIRDGLKQSSKPDDKFVIGVHDWRDRHAVDDSVQQPKVSDKAASSDDNKATSDGASNGPQGGSIT
PGSGEYTPARLASRDGKEAAAKADGLISRLFGDDKAEIHNKAHDVDAHHRDFPPHEGLWVTITPTSSASPFFDTL
LVLVISPLVTLTVVYALLIVRARIRRRRWRAPKSVVDRLPVRTYHTAVSSPSLSPRLPSPSGATPTTPLLQHSPT
RSRPRSRTTTGVLPSENLLVPTPAVPTPAGSAATGTRPEHEKGAGGFSAEWRKYMGRQVECVVCLEEYVDGVSRV
MSLPCGHEFHADCITPWLTTRRRTCPICKGDVVRSLARGARDGPRYEPYNDGADDDLDAEASGSRAMDGSSDLER
GILSPRPERDSSGAGRHEGWLGLLSNSFAPRTRQRSQSPQRGVRDR*
Coding >Ophun1|2777
ATGCGGCCGCCCCGCATCGCCGTCCTCGCCCTCTTCCTCGCCGCCTCCATCTTCATCCTCGGCCGCGCCTTCACT
CCGTCCTCCCGACCTCATGCCTCGTCGTCATATCCCTCAGAGGCCCGCTCCTCTCGCTCCGTCTTCGGCTTCGTC
TACTACAACACGCCCTTCTCGCTCTTCCCTCCTAATGCTGCCATCAGCTTGACCGACGACAACAGCACCTCCTTC
GCCGCCCGTCCCGCCGCCTTTGGGCCCAAGCTCGCCGCTCTCGGCCTGAGTGGCCAGCTGTGGGTTGGCAGCGGC
TTCGCCGAGGATAGTCAGGACGGCGATGGGGAGCTCGGATGCAGTGACCTCCCCGGCTGGGGCACCGGCAATATC
CGCGCCGGCCTCCGCAGCTCCTTTCGCGCTGACATGTCCAAGCCGTCTTCGTCTTCGTCGTCGTCCTCCTCCTCC
TCCTCCGCTCACCTCCTAGATCCGGACCACGTCATTGCCGCAAAGGCTCGTCCGGCCCGCCGTGTCCACGCCCGC
TCTTCCCTCTCGCGACGCGACTCATCATCCTCCTCCTCTACCTCCTCCTCTTCCGCCCACGCCGATATCCAGTCC
ATCCAAGAAGCCGCCGAGATCCAGGGCAAGGTTGTCCTGCTCATGCGCGGCGGCTGCGGCTTCCTGGAAAAGGTC
ATGTGGGCTCAGCGGCGAGGCGCCATCGCCGTCATCGTCGGCGACAACCAAAAGGGCGGGCCGCTCATCCAGATG
TTCGCCCACGGCGACGAGGTCGAGAACGTGACGGTGCCCTCCGTCTTCACCGCCCGCACCACAGCCCATCTTCTG
TCGTCGTTGACGCAGCCGGGCAGCTTCATCGAGGATACGCTCGACGACAGCGGAAACCCCGTTCGCAAGGTCCAG
CAGGGCCCCAAAAAGTCCGACGGCAAGACTCGCACCCTCAAGCCCGCCGCTTCGCCGCCCGCCGGCTCCCCCAAG
TCTAAGGCAAGGAGGGCCCTCAGGCCGGCGTCGAGCGACCCGGCGGCGAACCGCGGCTGGCTTTCCAGGCTGTTT
GGCTGGCGCCAAGCACCTCTCGTGGCCGTCGACAAGAGCCGGCCCCCGAGCAGCGGCCGGCGCGACTGGGTTCTC
GTCGACAGCTGGAGCGACGATTCCGACAAGGTCATCAGGGACGGCCTGAAACAGTCGTCCAAGCCCGACGACAAA
TTCGTCATTGGCGTGCACGACTGGCGAGACCGCCATGCCGTCGACGACTCGGTACAGCAGCCCAAGGTCTCGGAC
AAGGCCGCCAGCTCCGACGACAACAAGGCGACATCTGACGGCGCCAGCAACGGCCCTCAGGGCGGGAGCATCACC
CCGGGAAGCGGCGAATACACACCCGCTCGCTTGGCGTCGAGGGACGGCAAGGAAGCGGCCGCAAAGGCCGACGGC
CTGATTTCGAGGCTTTTCGGCGACGACAAGGCCGAGATACACAACAAGGCGCACGACGTCGACGCCCATCACCGC
GACTTCCCACCGCACGAGGGCCTCTGGGTCACCATCACGCCGACGAGCAGCGCCAGCCCCTTCTTCGACACGCTC
CTCGTGCTTGTCATCAGCCCGCTGGTGACGCTGACGGTCGTCTACGCCCTCCTCATCGTCCGTGCCCGCATCCGC
CGGAGAAGGTGGAGGGCTCCCAAATCGGTCGTCGATCGGCTCCCGGTGCGGACGTACCACACGGCCGTGTCGTCC
CCGAGCCTATCTCCGAGGTTACCGTCGCCCTCGGGTGCGACACCGACTACGCCGCTGCTCCAACACAGCCCCACG
CGGTCACGGCCGCGGTCGAGGACCACGACGGGCGTCTTGCCGAGCGAAAACCTGCTGGTGCCTACGCCTGCCGTC
CCGACACCCGCGGGGTCCGCAGCAACCGGCACCCGGCCCGAGCACGAAAAGGGCGCCGGCGGCTTCTCTGCCGAG
TGGAGGAAGTACATGGGAAGGCAGGTCGAGTGCGTCGTGTGCCTGGAGGAGTACGTCGACGGTGTGAGCAGGGTC
ATGAGCCTGCCCTGCGGCCACGAGTTCCACGCCGACTGCATAACTCCCTGGTTAACGACGCGGCGACGGACGTGT
CCCATCTGCAAGGGAGACGTGGTCCGGTCCCTGGCCCGCGGCGCACGCGACGGCCCCCGCTACGAGCCCTATAAT
GACGGTGCCGACGACGACTTGGACGCCGAGGCCTCGGGCTCTCGTGCCATGGACGGCAGCTCGGACCTGGAGCGC
GGCATCCTCTCGCCCCGGCCAGAACGGGACTCGTCCGGGGCGGGCCGACACGAGGGCTGGCTGGGATTGCTGTCG
AACAGCTTCGCCCCGCGGACGAGACAACGATCGCAATCGCCTCAACGGGGGGTCCGAGATCGGTGA
Transcript >Ophun1|2777
ATGCGGCCGCCCCGCATCGCCGTCCTCGCCCTCTTCCTCGCCGCCTCCATCTTCATCCTCGGCCGCGCCTTCACT
CCGTCCTCCCGACCTCATGCCTCGTCGTCATATCCCTCAGAGGCCCGCTCCTCTCGCTCCGTCTTCGGCTTCGTC
TACTACAACACGCCCTTCTCGCTCTTCCCTCCTAATGCTGCCATCAGCTTGACCGACGACAACAGCACCTCCTTC
GCCGCCCGTCCCGCCGCCTTTGGGCCCAAGCTCGCCGCTCTCGGCCTGAGTGGCCAGCTGTGGGTTGGCAGCGGC
TTCGCCGAGGATAGTCAGGACGGCGATGGGGAGCTCGGATGCAGTGACCTCCCCGGCTGGGGCACCGGCAATATC
CGCGCCGGCCTCCGCAGCTCCTTTCGCGCTGACATGTCCAAGCCGTCTTCGTCTTCGTCGTCGTCCTCCTCCTCC
TCCTCCGCTCACCTCCTAGATCCGGACCACGTCATTGCCGCAAAGGCTCGTCCGGCCCGCCGTGTCCACGCCCGC
TCTTCCCTCTCGCGACGCGACTCATCATCCTCCTCCTCTACCTCCTCCTCTTCCGCCCACGCCGATATCCAGTCC
ATCCAAGAAGCCGCCGAGATCCAGGGCAAGGTTGTCCTGCTCATGCGCGGCGGCTGCGGCTTCCTGGAAAAGGTC
ATGTGGGCTCAGCGGCGAGGCGCCATCGCCGTCATCGTCGGCGACAACCAAAAGGGCGGGCCGCTCATCCAGATG
TTCGCCCACGGCGACGAGGTCGAGAACGTGACGGTGCCCTCCGTCTTCACCGCCCGCACCACAGCCCATCTTCTG
TCGTCGTTGACGCAGCCGGGCAGCTTCATCGAGGATACGCTCGACGACAGCGGAAACCCCGTTCGCAAGGTCCAG
CAGGGCCCCAAAAAGTCCGACGGCAAGACTCGCACCCTCAAGCCCGCCGCTTCGCCGCCCGCCGGCTCCCCCAAG
TCTAAGGCAAGGAGGGCCCTCAGGCCGGCGTCGAGCGACCCGGCGGCGAACCGCGGCTGGCTTTCCAGGCTGTTT
GGCTGGCGCCAAGCACCTCTCGTGGCCGTCGACAAGAGCCGGCCCCCGAGCAGCGGCCGGCGCGACTGGGTTCTC
GTCGACAGCTGGAGCGACGATTCCGACAAGGTCATCAGGGACGGCCTGAAACAGTCGTCCAAGCCCGACGACAAA
TTCGTCATTGGCGTGCACGACTGGCGAGACCGCCATGCCGTCGACGACTCGGTACAGCAGCCCAAGGTCTCGGAC
AAGGCCGCCAGCTCCGACGACAACAAGGCGACATCTGACGGCGCCAGCAACGGCCCTCAGGGCGGGAGCATCACC
CCGGGAAGCGGCGAATACACACCCGCTCGCTTGGCGTCGAGGGACGGCAAGGAAGCGGCCGCAAAGGCCGACGGC
CTGATTTCGAGGCTTTTCGGCGACGACAAGGCCGAGATACACAACAAGGCGCACGACGTCGACGCCCATCACCGC
GACTTCCCACCGCACGAGGGCCTCTGGGTCACCATCACGCCGACGAGCAGCGCCAGCCCCTTCTTCGACACGCTC
CTCGTGCTTGTCATCAGCCCGCTGGTGACGCTGACGGTCGTCTACGCCCTCCTCATCGTCCGTGCCCGCATCCGC
CGGAGAAGGTGGAGGGCTCCCAAATCGGTCGTCGATCGGCTCCCGGTGCGGACGTACCACACGGCCGTGTCGTCC
CCGAGCCTATCTCCGAGGTTACCGTCGCCCTCGGGTGCGACACCGACTACGCCGCTGCTCCAACACAGCCCCACG
CGGTCACGGCCGCGGTCGAGGACCACGACGGGCGTCTTGCCGAGCGAAAACCTGCTGGTGCCTACGCCTGCCGTC
CCGACACCCGCGGGGTCCGCAGCAACCGGCACCCGGCCCGAGCACGAAAAGGGCGCCGGCGGCTTCTCTGCCGAG
TGGAGGAAGTACATGGGAAGGCAGGTCGAGTGCGTCGTGTGCCTGGAGGAGTACGTCGACGGTGTGAGCAGGGTC
ATGAGCCTGCCCTGCGGCCACGAGTTCCACGCCGACTGCATAACTCCCTGGTTAACGACGCGGCGACGGACGTGT
CCCATCTGCAAGGGAGACGTGGTCCGGTCCCTGGCCCGCGGCGCACGCGACGGCCCCCGCTACGAGCCCTATAAT
GACGGTGCCGACGACGACTTGGACGCCGAGGCCTCGGGCTCTCGTGCCATGGACGGCAGCTCGGACCTGGAGCGC
GGCATCCTCTCGCCCCGGCCAGAACGGGACTCGTCCGGGGCGGGCCGACACGAGGGCTGGCTGGGATTGCTGTCG
AACAGCTTCGCCCCGCGGACGAGACAACGATCGCAATCGCCTCAACGGGGGGTCCGAGATCGGTGA
Gene >Ophun1|2777
ATGCGGCCGCCCCGCATCGCCGTCCTCGCCCTCTTCCTCGCCGCCTCCATCTTCATCCTCGGCCGCGCCTTCACT
CCGTCCTCCCGACCTCATGCCTCGTCGTCATATCCCTCAGAGGCCCGCTCCTCTCGCTCCGTCTTCGGCTTCGTC
TACTACAACACGCCCTTCTCGCTCTTCCCTCCTAATGCTGCCATCAGCTTGACCGACGACAACAGCACCTCCTTC
GCCGCCCGTCCCGCCGCCTTTGGGCCCAAGCTCGCCGCTCTCGGCCTGAGTGGCCAGCTGTGGGTTGGCAGCGGC
TTCGCCGAGGATAGTCAGGACGGCGATGGGGAGCTCGGATGCAGTGACCTCCCCGGCTGGGGCACCGGCAATATC
CGCGCCGGCCTCCGCAGCTCCTTTCGCGCTGACATGTCCAAGCCGTCTTCGTCTTCGTCGTCGTCCTCCTCCTCC
TCCTCCGCTCACCTCCTAGATCCGGACCACGTCATTGCCGCAAAGGCTCGTCCGGCCCGCCGTGTCCACGCCCGC
TCTTCCCTCTCGCGACGCGACTCATCATCCTCCTCCTCTACCTCCTCCTCTTCCGCCCACGCCGATATCCAGTCC
ATCCAAGAAGCCGCCGAGATCCAGGGCAAGGTTGTCCTGCTCATGCGCGGCGGCTGCGGCTTCCTGGAAAAGGTC
ATGTGGGCTCAGCGGCGAGGCGCCATCGCCGTCATCGTCGGCGACAACCAAAAGGGCGGGCCGCTCATCCAGATG
TTCGCCCACGGCGACGAGGTCGAGAACGTGACGGTGCCCTCCGTCTTCACCGCCCGCACCACAGCCCATCTTCTG
TCGTCGTTGACGCAGCCGGGCAGCTTCATCGAGGATACGCTCGACGACAGCGGAAACCCCGTTCGCAAGGTCCAG
CAGGGCCCCAAAAAGTCCGACGGCAAGACTCGCACCCTCAAGCCCGCCGCTTCGCCGCCCGCCGGCTCCCCCAAG
TCTAAGGCAAGGAGGGCCCTCAGGCCGGCGTCGAGCGACCCGGCGGCGAACCGCGGCTGGCTTTCCAGGCTGTTT
GGCTGGCGCCAAGCACCTCTCGTGGCCGTCGACAAGAGCCGGCCCCCGAGCAGCGGCCGGCGCGACTGGGTTCTC
GTCGACAGCTGGAGCGACGATTCCGACAAGGTCATCAGGGACGGCCTGAAACAGTCGTCCAAGCCCGACGACAAA
TTCGTCATTGGCGTGCACGACTGGCGAGACCGCCATGCCGTCGACGACTCGGTACAGCAGCCCAAGGTCTCGGAC
AAGGCCGCCAGCTCCGACGACAACAAGGCGACATCTGACGGCGCCAGCAACGGCCCTCAGGGCGGGAGCATCACC
CCGGGAAGCGGCGAATACACACCCGCTCGCTTGGCGTCGAGGGACGGCAAGGAAGCGGCCGCAAAGGCCGACGGC
CTGATTTCGAGGCTTTTCGGCGACGACAAGGCCGAGATACACAACAAGGCGCACGACGTCGACGCCCATCACCGC
GACTTCCCACCGCACGAGGGCCTCTGGGTCACCATCACGCCGACGAGCAGCGCCAGCCCCTTCTTCGACACGCTC
CTCGTGCTTGTCATCAGCCCGCTGGTGACGCTGACGGTCGTCTACGCCCTCCTCATCGTCCGTGCCCGCATCCGC
CGGAGAAGGTGGAGGGCTCCCAAATCGGTCGTCGATCGGCTCCCGGTGCGGACGTACCACACGGCCGTGTCGTCC
CCGAGCCTATCTCCGAGGTTACCGTCGCCCTCGGGTGCGACACCGACTACGCCGCTGCTCCAACACAGCCCCACG
CGGTCACGGCCGCGGTCGAGGACCACGACGGGCGTCTTGCCGAGCGAAAACCTGCTGGTGCCTACGCCTGCCGTC
CCGACACCCGCGGGGTCCGCAGCAACCGGCACCCGGCCCGAGCACGAAAAGGGCGCCGGCGGCTTCTCTGCCGAG
TGGAGGAAGTACATGGGAAGGCAGGTCGAGTGCGTCGTGTGCCTGGAGGAGTACGTCGACGGTGTGAGCAGGGTC
ATGAGCCTGCCCTGCGGCCACGAGTTCCACGCCGACTGCATGTGAGTCAGTCCCTTACGGCGTCTCGCATCCTCG
TGTCGAATCGGTACTAACAAGACTCGCAACGCAGAACTCCCTGGTTAACGACGCGGCGACGGACGTGTCCCATCT
GCAAGGGAGACGTGGTCCGGTCCCTGGCCCGCGGCGCACGCGACGGCCCCCGCTACGAGCCCTATAATGACGGTG
CCGACGACGACTTGGACGCCGAGGCCTCGGGCTCTCGTGCCATGGACGGCAGCTCGGACCTGGAGCGCGGCATCC
TCTCGCCCCGGCCAGAACGGGACTCGTCCGGGGCGGGCCGACACGAGGGCTGGCTGGGATTGCTGTCGAACAGCT
TCGCCCCGCGGACGAGACAACGATCGCAATCGCCTCAACGGGGGGTCCGAGATCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail