Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2775
Gene name
LocationContig_248:4920..6069
Strand+
Gene length (bp)1149
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.8E-17 10 68
PF04193 PQ-loop PQ loop repeat 3.9E-20 203 259

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 10 291 2.0E-52
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 25 295 3.0E-48
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 10 300 2.0E-37
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 6 290 7.0E-36
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 2 298 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 10 291 2.0E-52
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 25 295 3.0E-48
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 10 300 2.0E-37
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 6 290 7.0E-36
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 2 298 1.0E-23
sp|Q5ZJX0|LAAT1_CHICK Lysosomal amino acid transporter 1 homolog OS=Gallus gallus GN=PQLC2 PE=2 SV=1 8 294 1.0E-19
sp|Q6ZP29|LAAT1_HUMAN Lysosomal amino acid transporter 1 homolog OS=Homo sapiens GN=PQLC2 PE=1 SV=1 15 290 3.0E-15
sp|B0BMY1|LAAT1_RAT Lysosomal amino acid transporter 1 homolog OS=Rattus norvegicus GN=Pqlc2 PE=1 SV=1 8 300 7.0E-14
sp|Q8C4N4|LAAT1_MOUSE Lysosomal amino acid transporter 1 homolog OS=Mus musculus GN=Pqlc2 PE=2 SV=1 27 290 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 45 67 22
3 72 94 22
4 161 183 22
5 198 220 22
6 233 255 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2775
MASSAVTDALSGIFGSISLTAWIFLLLPQLYANFKAKSADGLSLVFLFVWSLGDIANLSGALLTNLAPSAVALAG
YFCILDLTLISQCLYYNALNAKLPRSNDSDVDADPEHSPLLADARERSADLGVVVESSAPSSQKRAASAAESNAS
TGSWTRNCLSLLGVYLIGLAGWFVSYKAGAWGHTPPSAPELPPAKHDMSATVGVVLGYVSAVFYLCARIPQIVKN
HREKSCQGLSLLFFMLSLTGNLTYGLSLIAYSQEADYLVKSLPWLLGSLGTMVEDGAIFVQFRLYAGGSRVEDSD
L*
Coding >Ophun1|2775
ATGGCCTCGTCCGCTGTAACCGACGCCTTGTCTGGCATCTTTGGCAGCATCAGTCTGACCGCTTGGATTTTCTTG
CTGCTGCCCCAACTGTATGCCAACTTCAAGGCCAAGAGCGCCGATGGCCTGAGCCTGGTCTTTCTCTTCGTCTGG
TCGCTGGGCGACATCGCCAATCTCTCAGGCGCCCTGCTCACTAATCTGGCGCCCAGCGCCGTCGCCCTCGCCGGC
TACTTCTGCATCCTGGACCTCACTCTCATCAGCCAATGTCTCTACTACAACGCTCTCAACGCCAAACTCCCCCGT
TCGAATGACTCGGACGTCGACGCCGACCCGGAACATTCGCCCCTGTTGGCCGACGCTCGCGAACGCTCCGCTGAC
TTGGGCGTCGTCGTCGAGTCGTCGGCGCCATCGAGTCAGAAACGAGCCGCCTCCGCCGCTGAATCGAATGCCAGC
ACCGGTTCGTGGACTCGTAACTGCCTGAGCCTGCTCGGCGTTTACCTTATCGGCCTGGCCGGCTGGTTCGTCTCG
TACAAGGCCGGTGCATGGGGCCACACCCCGCCGAGCGCCCCTGAGCTCCCTCCGGCGAAGCATGACATGAGCGCG
ACCGTCGGCGTCGTCTTGGGCTACGTCAGCGCCGTCTTTTACCTCTGCGCTCGGATCCCGCAGATTGTCAAGAAC
CACCGAGAAAAGTCATGTCAAGGCTTGTCGTTGCTGTTCTTCATGCTGTCCCTGACGGGCAACCTGACATACGGC
CTGAGTCTGATTGCCTACTCGCAGGAGGCGGATTACCTGGTCAAGTCGCTGCCCTGGCTGCTGGGCTCGCTCGGC
ACCATGGTAGAGGACGGGGCGATTTTCGTCCAGTTTCGGCTTTACGCCGGCGGGAGTCGAGTCGAGGACTCGGAC
CTTTAG
Transcript >Ophun1|2775
ATGGCCTCGTCCGCTGTAACCGACGCCTTGTCTGGCATCTTTGGCAGCATCAGTCTGACCGCTTGGATTTTCTTG
CTGCTGCCCCAACTGTATGCCAACTTCAAGGCCAAGAGCGCCGATGGCCTGAGCCTGGTCTTTCTCTTCGTCTGG
TCGCTGGGCGACATCGCCAATCTCTCAGGCGCCCTGCTCACTAATCTGGCGCCCAGCGCCGTCGCCCTCGCCGGC
TACTTCTGCATCCTGGACCTCACTCTCATCAGCCAATGTCTCTACTACAACGCTCTCAACGCCAAACTCCCCCGT
TCGAATGACTCGGACGTCGACGCCGACCCGGAACATTCGCCCCTGTTGGCCGACGCTCGCGAACGCTCCGCTGAC
TTGGGCGTCGTCGTCGAGTCGTCGGCGCCATCGAGTCAGAAACGAGCCGCCTCCGCCGCTGAATCGAATGCCAGC
ACCGGTTCGTGGACTCGTAACTGCCTGAGCCTGCTCGGCGTTTACCTTATCGGCCTGGCCGGCTGGTTCGTCTCG
TACAAGGCCGGTGCATGGGGCCACACCCCGCCGAGCGCCCCTGAGCTCCCTCCGGCGAAGCATGACATGAGCGCG
ACCGTCGGCGTCGTCTTGGGCTACGTCAGCGCCGTCTTTTACCTCTGCGCTCGGATCCCGCAGATTGTCAAGAAC
CACCGAGAAAAGTCATGTCAAGGCTTGTCGTTGCTGTTCTTCATGCTGTCCCTGACGGGCAACCTGACATACGGC
CTGAGTCTGATTGCCTACTCGCAGGAGGCGGATTACCTGGTCAAGTCGCTGCCCTGGCTGCTGGGCTCGCTCGGC
ACCATGGTAGAGGACGGGGCGATTTTCGTCCAGTTTCGGCTTTACGCCGGCGGGAGTCGAGTCGAGGACTCGGAC
CTTTAG
Gene >Ophun1|2775
ATGGCCTCGTCCGCTGTAACCGACGCCTTGTCTGGCATCTTTGGCAGCATCAGTCTGACCGCTTGGATTTTCTTG
CTGGTGCGTCACCACTCACCACCCCAGAGCCTATGCGAGTCACTCACTGATTGACCGCCTGTCAGCTGCCCCAAC
TGTATGCCAACTTCAAGGCCAAGAGCGCCGATGGCCTGAGCCTGGTCTTTCTCTTCGTCTGGTCGCTGGGCGACA
TCGCCAATCTCTCAGGTGCCTCATCCTTCCCGACCATCGGACATGGACACGGAGGTTGACAGTCGAGTCCAAACC
CAGGCGCCCTGCTCACTAATCTGGCGCCCAGCGCCGTCGCCCTCGCCGGCTACTTCTGCATCCTGGACCTCACTC
TCATCAGCCAATGTCTCTACTACAACGCTCTCAACGCCAAACTCCCCCGTTCGAATGACTCGGACGTCGACGCCG
ACCCGGAACATTCGCCCCTGTTGGCCGACGCTCGCGAACGCTCCGCTGACTTGGGCGTCGTCGTCGAGTCGTCGG
CGCCATCGAGTCAGAAACGAGCCGCCTCCGCCGCTGAATCGAATGCCAGCACCGGTTCGTGGACTCGTAACTGCC
TGAGCCTGCTCGGCGTTTACCTTATCGGCCTGGCCGGCTGGTTCGTCTCGTACAAGGCCGGTGCATGGGGCCACA
CCCCGCCGAGCGCCCCTGAGCTCCCTCCGGCGAAGCATGACATGAGCGCGACCGTCGGCGTCGTCTTGGGCTACG
TCAGCGCCGTCTTTTACCTCTGGTGAGTTTCGTTTGCGAACCGGTTCCGCCGGAAAGACGGCTGACGGCCATCTC
GCAGCGCTCGGATCCCGCAGATTGTCAAGAACCACCGAGAAAAGTCATGTCAAGGTCAGGGACCTCGTCTCATCC
CCAGGGGGGCCAAACAAAAGTTTTCTAACGAGCGCCTCAGGCTTGTCGTTGCTGTTCTTCATGCTGTCCCTGACG
GGCAACCTGACATACGGCCTGAGTCTGATTGCCTACTCGCAGGAGGCGGATTACCTGGTCAAGTCGCTGCCCTGG
CTGCTGGGCTCGCTCGGCACCATGGTAGAGGACGGGGCGATTTTCGTCCAGTTTCGGCTTTACGCCGGCGGGAGT
CGAGTCGAGGACTCGGACCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail