Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2767
Gene name
LocationContig_247:4848..8583
Strand+
Gene length (bp)3735
Transcript length (bp)3636
Coding sequence length (bp)3636
Protein length (aa) 1212

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 3.9E-22 51 135
PF11915 DUF3433 Protein of unknown function (DUF3433) 9.4E-16 659 746

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 46 68 22
3 115 134 19
4 497 519 22
5 618 640 22
6 660 677 17
7 723 745 22
8 1093 1112 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2767
MGAPILISFAIISLLLAAAIEVLAQQSSANGGLALSPSIQEIPRPAVLASKYVPVVVATLYGIVWAWVDQDVKRM
QPWFELSRPGGARARKSLFLSYPHDFIVFLPWRAAKRRHWGVLLSSTMTIIILFLLTPLQPTITGIDPVSHTEPV
NIATRSLIGTPLGLTGGNFLSEAFMINNFDQPFSPFITRNFALLPFYVDPEVARRSRDANVTTTTTKFTTELTCR
QPEILTGSASSAGQDGRDGPVMLSFQRNSSNYYNISDGHGCMIKIRTLTDKESPYDVSYMYDTPSSGRIWTPDPR
FDKPDCGTRPGRPLALVWEKFVSQNDSMKTHRNITARLCDINYYQQEHEVTITAGDSRLHLDSLQPVSPRRPMAN
FSEDYFEAMIQQFRGALYRTTSEDITAIEVPRVLSEPIDGLRSTCDGHQCRVSGVVKFVFTGQNLSVADISHPDK
LVHEFSRARNFLFSMAVHHTIVNQTEDSNEYSASAAFPMTGIVVSRVMSALVEALFILSAISALVLLWICKKSPC
RLESNPNSISRLCRLCHDSRGAIRPFQGLDMADEKALKRALGKERFRLSQRGNELYLERIVEADSVSVSDETAEV
EASVDKDQRPFEMTRKAGVVFLIVLLGAIIAIVCTKVTEVRKRGIQRPFSNNEITRILERYLPVIYGTIAYSFWL
ILNRDLCTLQPFRDLCAGNAPPSRSIATTYSAIPPSLTLWRAFKARHWVLTMLCSVALLGRLLGISLGTLFNENR
GIVAYPQHFEPLTASGFNDQSLVDFHRLNQGYTPTYDIYHLYANVTTGTPLPPWASIDYFFQPHNLARDGPVSSD
ATYQLTTRGFGVNANCTSLYQLPAPEPEDNSTCPTAINVAANQLQSYIKSVNPGQTRVSPCSLEVLAPSSLNDTG
VCPFDFVLSWARARLYCATRVVHGRAEPSATAIYCKPFFETALFNISVDSAGNVASYAKTSETESTLGYPDFDRH
ARLLLRYALPFPRNYSSMRKWQKNNWHSDVHAADWISLLISETMGSRDFLDPLSPPPNTFELIPIVQQLYRKGFA
ILLGRHHDLFNQAEATTRSAGNSPVTGFKLVTETRIFFDETSLIITLTILSIDILVAIILYTRPTLRILPRMPTS
IASTIAYVASSHLVHSPEGPSESDSFSFGRYVGLDGKSHVGIERASRVTLIKPSSDAKGSLLSKVRGFRRRRRSM
TPGEQGPEYTA*
Coding >Ophun1|2767
ATGGGCGCTCCCATCCTCATCTCCTTCGCCATAATCTCCCTCCTCCTAGCCGCCGCCATCGAAGTCCTCGCCCAA
CAAAGCAGCGCAAACGGCGGCCTCGCTCTCTCGCCCTCTATCCAGGAGATCCCGCGGCCGGCAGTGCTGGCGTCC
AAGTACGTGCCTGTCGTGGTGGCGACGCTCTATGGCATTGTTTGGGCTTGGGTCGATCAGGATGTCAAGAGGATG
CAGCCTTGGTTTGAGCTTTCGAGGCCTGGGGGGGCGAGGGCTAGGAAGTCGTTGTTTCTGAGCTATCCGCATGAC
TTTATTGTCTTTTTGCCGTGGAGGGCGGCCAAGAGGAGACACTGGGGCGTCCTCCTCTCCAGCACAATGACCATC
ATCATCCTCTTCCTCCTCACCCCCCTCCAACCAACCATCACAGGCATCGACCCAGTCAGTCACACCGAGCCAGTC
AACATAGCAACGCGATCCCTCATCGGCACCCCCCTCGGTCTCACAGGCGGCAACTTTCTATCCGAAGCCTTCATG
ATCAACAACTTTGACCAGCCCTTCTCGCCCTTCATCACCCGGAACTTCGCCCTCCTCCCGTTCTACGTCGATCCC
GAGGTTGCGCGAAGGAGCAGAGATGCGAATGTCACGACGACGACGACCAAGTTTACCACTGAGCTTACTTGTCGA
CAGCCGGAAATCTTGACGGGGTCCGCCTCTTCAGCCGGTCAAGACGGTCGCGATGGGCCCGTGATGCTCTCATTT
CAGCGCAACAGCAGCAACTACTATAACATCTCGGACGGACACGGCTGTATGATCAAGATCAGGACCCTTACTGAC
AAGGAGTCGCCCTACGACGTCAGCTACATGTACGACACCCCCTCCTCAGGCCGCATCTGGACCCCCGATCCCAGG
TTCGACAAGCCAGACTGCGGAACCAGGCCGGGTCGGCCACTGGCCCTCGTCTGGGAGAAATTCGTCTCACAGAAC
GACTCCATGAAGACGCACCGGAACATCACCGCCCGTCTCTGCGATATAAATTACTACCAGCAGGAACACGAAGTC
ACTATCACCGCGGGAGACTCCAGACTCCATCTGGATTCTTTGCAGCCTGTCTCTCCTCGACGACCAATGGCCAAC
TTCTCAGAAGACTATTTCGAAGCAATGATCCAACAATTCAGGGGAGCTCTCTACAGGACCACTTCCGAGGATATA
ACAGCAATAGAAGTTCCCAGAGTCCTCTCGGAACCCATTGACGGCCTTCGCTCAACCTGCGATGGACATCAGTGC
CGCGTCAGCGGCGTTGTCAAGTTTGTCTTCACGGGACAGAACCTCTCTGTTGCCGACATTTCTCATCCGGACAAA
CTCGTACATGAATTCAGCCGAGCTCGCAATTTTCTCTTCTCCATGGCTGTTCACCACACTATCGTCAACCAGACT
GAAGATAGCAACGAATACAGCGCATCCGCTGCCTTTCCCATGACGGGAATAGTGGTCAGCAGAGTCATGTCCGCC
CTGGTAGAAGCCCTCTTCATCCTCAGCGCCATATCAGCCCTCGTCCTACTCTGGATCTGCAAGAAGTCTCCCTGT
CGCCTGGAGTCGAACCCCAACTCCATCTCTCGTCTCTGCCGCCTCTGCCATGACTCTCGCGGGGCGATCCGTCCG
TTTCAAGGGCTGGATATGGCGGATGAGAAGGCGTTGAAACGTGCGCTGGGGAAGGAACGCTTTCGGCTTTCTCAG
CGGGGGAACGAGCTGTATCTTGAGAGGATCGTGGAGGCGGACAGCGTGAGTGTTAGCGATGAGACGGCTGAAGTT
GAGGCTTCGGTTGATAAAGATCAACGGCCGTTTGAGATGACTCGCAAGGCGGGCGTTGTCTTTCTCATCGTCTTG
CTGGGCGCCATCATCGCTATTGTCTGTACAAAGGTGACTGAAGTTCGCAAACGAGGGATACAACGCCCATTCTCA
AACAACGAAATCACCCGTATCCTAGAACGATACCTCCCGGTCATCTACGGAACCATCGCCTACTCCTTCTGGCTC
ATCCTCAACAGAGACCTCTGCACCCTACAGCCCTTCAGAGACCTGTGTGCCGGAAACGCGCCTCCAAGCCGGAGC
ATAGCAACAACCTACTCGGCCATTCCACCATCCTTGACGCTCTGGAGAGCCTTCAAGGCTCGACACTGGGTTCTC
ACCATGCTCTGTTCTGTTGCCTTGCTGGGCAGGCTCCTGGGCATCAGTCTGGGCACGCTCTTCAACGAAAATAGG
GGCATAGTTGCTTACCCACAACACTTTGAGCCTCTTACTGCGTCTGGCTTCAACGACCAGTCACTCGTCGACTTC
CACCGCCTCAACCAGGGCTATACCCCTACCTATGACATCTATCATCTATACGCCAACGTCACCACAGGTACACCG
CTTCCCCCGTGGGCATCCATCGACTACTTCTTCCAACCGCACAACCTCGCACGAGATGGTCCCGTCTCCTCAGAC
GCGACATATCAACTGACAACGCGTGGCTTCGGCGTCAACGCCAACTGCACATCCCTCTACCAGCTTCCAGCACCG
GAACCCGAAGACAACTCAACCTGTCCGACAGCCATCAACGTAGCCGCCAACCAGCTCCAATCATACATCAAGTCA
GTGAACCCAGGCCAAACACGCGTGTCACCTTGTTCGCTCGAGGTCCTCGCCCCTTCTTCACTCAATGACACCGGC
GTCTGCCCATTCGACTTTGTCCTCAGCTGGGCCAGAGCCAGATTATATTGCGCAACCCGGGTGGTCCACGGACGA
GCCGAGCCGAGCGCCACAGCCATCTACTGCAAACCGTTCTTCGAGACTGCCCTGTTCAACATCTCTGTTGATTCG
GCAGGAAACGTTGCCTCGTATGCCAAGACCAGCGAGACGGAGTCAACTCTGGGATACCCAGACTTTGATCGACAC
GCCCGGCTGCTGTTAAGATATGCTCTGCCCTTTCCTCGAAATTATAGCTCGATGAGAAAATGGCAGAAAAATAAC
TGGCATTCTGACGTGCATGCCGCCGACTGGATATCGCTATTGATATCCGAGACAATGGGGTCGCGAGACTTTCTC
GATCCGCTATCGCCTCCCCCGAACACATTCGAACTCATCCCCATTGTCCAACAGCTGTATCGCAAGGGTTTCGCC
ATCCTACTCGGACGCCATCACGATCTCTTCAACCAAGCCGAAGCCACAACACGATCCGCAGGAAACTCACCGGTA
ACAGGCTTCAAACTCGTCACCGAAACACGCATCTTCTTCGACGAAACCTCCCTCATCATCACCCTCACCATCCTA
TCCATCGACATCCTCGTCGCCATCATCCTCTACACCAGACCGACTCTCCGCATCCTCCCCCGAATGCCCACCTCG
ATCGCCTCGACGATAGCCTACGTCGCCTCCAGCCATCTCGTCCATTCGCCCGAAGGCCCCTCGGAGAGCGACAGC
TTCAGCTTCGGGCGGTATGTAGGGCTTGATGGGAAGTCGCATGTTGGCATCGAGAGGGCGAGCCGGGTGACGCTT
ATCAAGCCGTCGTCGGATGCCAAGGGGAGTCTGTTGAGTAAAGTACGGGGGTTTCGGCGGCGGAGGAGAAGTATG
ACGCCGGGCGAGCAAGGTCCAGAGTATACGGCCTAA
Transcript >Ophun1|2767
ATGGGCGCTCCCATCCTCATCTCCTTCGCCATAATCTCCCTCCTCCTAGCCGCCGCCATCGAAGTCCTCGCCCAA
CAAAGCAGCGCAAACGGCGGCCTCGCTCTCTCGCCCTCTATCCAGGAGATCCCGCGGCCGGCAGTGCTGGCGTCC
AAGTACGTGCCTGTCGTGGTGGCGACGCTCTATGGCATTGTTTGGGCTTGGGTCGATCAGGATGTCAAGAGGATG
CAGCCTTGGTTTGAGCTTTCGAGGCCTGGGGGGGCGAGGGCTAGGAAGTCGTTGTTTCTGAGCTATCCGCATGAC
TTTATTGTCTTTTTGCCGTGGAGGGCGGCCAAGAGGAGACACTGGGGCGTCCTCCTCTCCAGCACAATGACCATC
ATCATCCTCTTCCTCCTCACCCCCCTCCAACCAACCATCACAGGCATCGACCCAGTCAGTCACACCGAGCCAGTC
AACATAGCAACGCGATCCCTCATCGGCACCCCCCTCGGTCTCACAGGCGGCAACTTTCTATCCGAAGCCTTCATG
ATCAACAACTTTGACCAGCCCTTCTCGCCCTTCATCACCCGGAACTTCGCCCTCCTCCCGTTCTACGTCGATCCC
GAGGTTGCGCGAAGGAGCAGAGATGCGAATGTCACGACGACGACGACCAAGTTTACCACTGAGCTTACTTGTCGA
CAGCCGGAAATCTTGACGGGGTCCGCCTCTTCAGCCGGTCAAGACGGTCGCGATGGGCCCGTGATGCTCTCATTT
CAGCGCAACAGCAGCAACTACTATAACATCTCGGACGGACACGGCTGTATGATCAAGATCAGGACCCTTACTGAC
AAGGAGTCGCCCTACGACGTCAGCTACATGTACGACACCCCCTCCTCAGGCCGCATCTGGACCCCCGATCCCAGG
TTCGACAAGCCAGACTGCGGAACCAGGCCGGGTCGGCCACTGGCCCTCGTCTGGGAGAAATTCGTCTCACAGAAC
GACTCCATGAAGACGCACCGGAACATCACCGCCCGTCTCTGCGATATAAATTACTACCAGCAGGAACACGAAGTC
ACTATCACCGCGGGAGACTCCAGACTCCATCTGGATTCTTTGCAGCCTGTCTCTCCTCGACGACCAATGGCCAAC
TTCTCAGAAGACTATTTCGAAGCAATGATCCAACAATTCAGGGGAGCTCTCTACAGGACCACTTCCGAGGATATA
ACAGCAATAGAAGTTCCCAGAGTCCTCTCGGAACCCATTGACGGCCTTCGCTCAACCTGCGATGGACATCAGTGC
CGCGTCAGCGGCGTTGTCAAGTTTGTCTTCACGGGACAGAACCTCTCTGTTGCCGACATTTCTCATCCGGACAAA
CTCGTACATGAATTCAGCCGAGCTCGCAATTTTCTCTTCTCCATGGCTGTTCACCACACTATCGTCAACCAGACT
GAAGATAGCAACGAATACAGCGCATCCGCTGCCTTTCCCATGACGGGAATAGTGGTCAGCAGAGTCATGTCCGCC
CTGGTAGAAGCCCTCTTCATCCTCAGCGCCATATCAGCCCTCGTCCTACTCTGGATCTGCAAGAAGTCTCCCTGT
CGCCTGGAGTCGAACCCCAACTCCATCTCTCGTCTCTGCCGCCTCTGCCATGACTCTCGCGGGGCGATCCGTCCG
TTTCAAGGGCTGGATATGGCGGATGAGAAGGCGTTGAAACGTGCGCTGGGGAAGGAACGCTTTCGGCTTTCTCAG
CGGGGGAACGAGCTGTATCTTGAGAGGATCGTGGAGGCGGACAGCGTGAGTGTTAGCGATGAGACGGCTGAAGTT
GAGGCTTCGGTTGATAAAGATCAACGGCCGTTTGAGATGACTCGCAAGGCGGGCGTTGTCTTTCTCATCGTCTTG
CTGGGCGCCATCATCGCTATTGTCTGTACAAAGGTGACTGAAGTTCGCAAACGAGGGATACAACGCCCATTCTCA
AACAACGAAATCACCCGTATCCTAGAACGATACCTCCCGGTCATCTACGGAACCATCGCCTACTCCTTCTGGCTC
ATCCTCAACAGAGACCTCTGCACCCTACAGCCCTTCAGAGACCTGTGTGCCGGAAACGCGCCTCCAAGCCGGAGC
ATAGCAACAACCTACTCGGCCATTCCACCATCCTTGACGCTCTGGAGAGCCTTCAAGGCTCGACACTGGGTTCTC
ACCATGCTCTGTTCTGTTGCCTTGCTGGGCAGGCTCCTGGGCATCAGTCTGGGCACGCTCTTCAACGAAAATAGG
GGCATAGTTGCTTACCCACAACACTTTGAGCCTCTTACTGCGTCTGGCTTCAACGACCAGTCACTCGTCGACTTC
CACCGCCTCAACCAGGGCTATACCCCTACCTATGACATCTATCATCTATACGCCAACGTCACCACAGGTACACCG
CTTCCCCCGTGGGCATCCATCGACTACTTCTTCCAACCGCACAACCTCGCACGAGATGGTCCCGTCTCCTCAGAC
GCGACATATCAACTGACAACGCGTGGCTTCGGCGTCAACGCCAACTGCACATCCCTCTACCAGCTTCCAGCACCG
GAACCCGAAGACAACTCAACCTGTCCGACAGCCATCAACGTAGCCGCCAACCAGCTCCAATCATACATCAAGTCA
GTGAACCCAGGCCAAACACGCGTGTCACCTTGTTCGCTCGAGGTCCTCGCCCCTTCTTCACTCAATGACACCGGC
GTCTGCCCATTCGACTTTGTCCTCAGCTGGGCCAGAGCCAGATTATATTGCGCAACCCGGGTGGTCCACGGACGA
GCCGAGCCGAGCGCCACAGCCATCTACTGCAAACCGTTCTTCGAGACTGCCCTGTTCAACATCTCTGTTGATTCG
GCAGGAAACGTTGCCTCGTATGCCAAGACCAGCGAGACGGAGTCAACTCTGGGATACCCAGACTTTGATCGACAC
GCCCGGCTGCTGTTAAGATATGCTCTGCCCTTTCCTCGAAATTATAGCTCGATGAGAAAATGGCAGAAAAATAAC
TGGCATTCTGACGTGCATGCCGCCGACTGGATATCGCTATTGATATCCGAGACAATGGGGTCGCGAGACTTTCTC
GATCCGCTATCGCCTCCCCCGAACACATTCGAACTCATCCCCATTGTCCAACAGCTGTATCGCAAGGGTTTCGCC
ATCCTACTCGGACGCCATCACGATCTCTTCAACCAAGCCGAAGCCACAACACGATCCGCAGGAAACTCACCGGTA
ACAGGCTTCAAACTCGTCACCGAAACACGCATCTTCTTCGACGAAACCTCCCTCATCATCACCCTCACCATCCTA
TCCATCGACATCCTCGTCGCCATCATCCTCTACACCAGACCGACTCTCCGCATCCTCCCCCGAATGCCCACCTCG
ATCGCCTCGACGATAGCCTACGTCGCCTCCAGCCATCTCGTCCATTCGCCCGAAGGCCCCTCGGAGAGCGACAGC
TTCAGCTTCGGGCGGTATGTAGGGCTTGATGGGAAGTCGCATGTTGGCATCGAGAGGGCGAGCCGGGTGACGCTT
ATCAAGCCGTCGTCGGATGCCAAGGGGAGTCTGTTGAGTAAAGTACGGGGGTTTCGGCGGCGGAGGAGAAGTATG
ACGCCGGGCGAGCAAGGTCCAGAGTATACGGCCTAA
Gene >Ophun1|2767
ATGGGCGCTCCCATCCTCATCTCCTTCGCCATAATCTCCCTCCTCCTAGCCGCCGCCATCGAAGTCCTCGCCCAA
CAAAGCAGCGCAAACGGCGGCCTCGCTCTCTCGCCCTCTATCCAGGAGATCCCGCGGCCGGCAGTGCTGGCGTCC
AAGTACGTGCCTGTCGTGGTGGCGACGCTCTATGGCATTGTTTGGGCTTGGGTCGATCAGGATGTCAAGAGGATG
CAGCCTTGGTTTGAGCTTTCGAGGCCTGGGGGGGCGAGGGCTAGGAAGTCGTTGTTTCTGAGCTATCCGCATGAC
TTTATTGTCTTTTTGCCGTGGAGGGCGGCCAAGAGGAGGTTTGTGATTCTTCTATCCAGTTGCCGTCAGTTGCTG
ATCTCAACTCCTCAGACACTGGGGCGTCCTCCTCTCCAGCACAATGACCATCATCATCCTCTTCCTCCTCACCCC
CCTCCAACCAACCATCACAGGCATCGACCCAGTCAGTCACACCGAGCCAGTCAACATAGCAACGCGATCCCTCAT
CGGCACCCCCCTCGGTCTCACAGGCGGCAACTTTCTATCCGAAGCCTTCATGATCAACAACTTTGACCAGCCCTT
CTCGCCCTTCATCACCCGGAACTTCGCCCTCCTCCCGTTCTACGTCGATCCCGAGGTTGCGCGAAGGAGCAGAGA
TGCGAATGTCACGACGACGACGACCAAGTTTACCACTGAGCTTACTTGTCGACAGCCGGAAATCTTGACGGGGTC
CGCCTCTTCAGCCGGTCAAGACGGTCGCGATGGGCCCGTGATGCTCTCATTTCAGCGCAACAGCAGCAACTACTA
TAACATCTCGGACGGACACGGCTGTATGATCAAGATCAGGACCCTTACTGACAAGGAGTCGCCCTACGACGTCAG
CTACATGTACGACACCCCCTCCTCAGGCCGCATCTGGACCCCCGATCCCAGGTTCGACAAGCCAGACTGCGGAAC
CAGGCCGGGTCGGCCACTGGCCCTCGTCTGGGAGAAATTCGTCTCACAGAACGACTCCATGAAGACGCACCGGAA
CATCACCGCCCGTCTCTGCGATATAAATTACTACCAGCAGGAACACGAAGTCACTATCACCGCGGGAGACTCCAG
ACTCCATCTGGATTCTTTGCAGCCTGTCTCTCCTCGACGACCAATGGCCAACTTCTCAGAAGACTATTTCGAAGC
AATGATCCAACAATTCAGGGGAGCTCTCTACAGGACCACTTCCGAGGATATAACAGCAATAGAAGTTCCCAGAGT
CCTCTCGGAACCCATTGACGGCCTTCGCTCAACCTGCGATGGACATCAGTGCCGCGTCAGCGGCGTTGTCAAGTT
TGTCTTCACGGGACAGAACCTCTCTGTTGCCGACATTTCTCATCCGGACAAACTCGTACATGAATTCAGCCGAGC
TCGCAATTTTCTCTTCTCCATGGCTGTTCACCACACTATCGTCAACCAGACTGAAGATAGCAACGAATACAGCGC
ATCCGCTGCCTTTCCCATGACGGGAATAGTGGTCAGCAGAGTCATGTCCGCCCTGGTAGAAGCCCTCTTCATCCT
CAGCGCCATATCAGCCCTCGTCCTACTCTGGATCTGCAAGAAGTCTCCCTGTCGCCTGGAGTCGAACCCCAACTC
CATCTCTCGTCTCTGCCGCCTCTGCCATGACTCTCGCGGGGCGATCCGTCCGTTTCAAGGGCTGGATATGGCGGA
TGAGAAGGCGTTGAAACGTGCGCTGGGGAAGGAACGCTTTCGGCTTTCTCAGCGGGGGAACGAGCTGTATCTTGA
GAGGATCGTGGAGGCGGACAGCGTGAGTGTTAGCGATGAGACGGCTGAAGTTGAGGCTTCGGTTGATAAAGATCA
ACGGCCGTTTGAGATGACTCGCAAGGCGGGCGTTGTCTTTCTCATCGTCTTGCTGGGCGCCATCATCGCTATTGT
CTGTACAAAGGTGACTGAAGTTCGCAAACGAGGTAAGCGGAGCGTCTTGTCAGCTGTCAACATGCTGACTGCTAT
TCAGGGATACAACGCCCATTCTCAAACAACGAAATCACCCGTATCCTAGAACGATACCTCCCGGTCATCTACGGA
ACCATCGCCTACTCCTTCTGGCTCATCCTCAACAGAGACCTCTGCACCCTACAGCCCTTCAGAGACCTGTGTGCC
GGAAACGCGCCTCCAAGCCGGAGCATAGCAACAACCTACTCGGCCATTCCACCATCCTTGACGCTCTGGAGAGCC
TTCAAGGCTCGACACTGGGTTCTCACCATGCTCTGTTCTGTTGCCTTGCTGGGCAGGCTCCTGGGCATCAGTCTG
GGCACGCTCTTCAACGAAAATAGGGGCATAGTTGCTTACCCACAACACTTTGAGCCTCTTACTGCGTCTGGCTTC
AACGACCAGTCACTCGTCGACTTCCACCGCCTCAACCAGGGCTATACCCCTACCTATGACATCTATCATCTATAC
GCCAACGTCACCACAGGTACACCGCTTCCCCCGTGGGCATCCATCGACTACTTCTTCCAACCGCACAACCTCGCA
CGAGATGGTCCCGTCTCCTCAGACGCGACATATCAACTGACAACGCGTGGCTTCGGCGTCAACGCCAACTGCACA
TCCCTCTACCAGCTTCCAGCACCGGAACCCGAAGACAACTCAACCTGTCCGACAGCCATCAACGTAGCCGCCAAC
CAGCTCCAATCATACATCAAGTCAGTGAACCCAGGCCAAACACGCGTGTCACCTTGTTCGCTCGAGGTCCTCGCC
CCTTCTTCACTCAATGACACCGGCGTCTGCCCATTCGACTTTGTCCTCAGCTGGGCCAGAGCCAGATTATATTGC
GCAACCCGGGTGGTCCACGGACGAGCCGAGCCGAGCGCCACAGCCATCTACTGCAAACCGTTCTTCGAGACTGCC
CTGTTCAACATCTCTGTTGATTCGGCAGGAAACGTTGCCTCGTATGCCAAGACCAGCGAGACGGAGTCAACTCTG
GGATACCCAGACTTTGATCGACACGCCCGGCTGCTGTTAAGATATGCTCTGCCCTTTCCTCGAAATTATAGCTCG
ATGAGAAAATGGCAGAAAAATAACTGGCATTCTGACGTGCATGCCGCCGACTGGATATCGCTATTGATATCCGAG
ACAATGGGGTCGCGAGACTTTCTCGATCCGCTATCGCCTCCCCCGAACACATTCGAACTCATCCCCATTGTCCAA
CAGCTGTATCGCAAGGGTTTCGCCATCCTACTCGGACGCCATCACGATCTCTTCAACCAAGCCGAAGCCACAACA
CGATCCGCAGGAAACTCACCGGTAACAGGCTTCAAACTCGTCACCGAAACACGCATCTTCTTCGACGAAACCTCC
CTCATCATCACCCTCACCATCCTATCCATCGACATCCTCGTCGCCATCATCCTCTACACCAGACCGACTCTCCGC
ATCCTCCCCCGAATGCCCACCTCGATCGCCTCGACGATAGCCTACGTCGCCTCCAGCCATCTCGTCCATTCGCCC
GAAGGCCCCTCGGAGAGCGACAGCTTCAGCTTCGGGCGGTATGTAGGGCTTGATGGGAAGTCGCATGTTGGCATC
GAGAGGGCGAGCCGGGTGACGCTTATCAAGCCGTCGTCGGATGCCAAGGGGAGTCTGTTGAGTAAAGTACGGGGG
TTTCGGCGGCGGAGGAGAAGTATGACGCCGGGCGAGCAAGGTCCAGAGTATACGGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail