Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2758
Gene name
LocationContig_246:262..5215
Strand-
Gene length (bp)4953
Transcript length (bp)4953
Coding sequence length (bp)4953
Protein length (aa) 1651

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 978 1000 22
2 1013 1035 22
3 1045 1064 19
4 1131 1153 22
5 1163 1182 19
6 1243 1265 22
7 1275 1297 22
8 1327 1349 22
9 1359 1381 22
10 1417 1439 22
11 1449 1471 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2758
MEAGDFDETPAPSGRPSMSELRTDGDDGSVREIDRGSGPRHHLLKTSTSGSILVDGDELVSTPRTRQQASKAFKA
LLPLQVSTVSPENKVASPMTPSSPVRTAFGNLLSDRATNRPLRQPDPPTVAQDRHQEVDVPDERGFRQFDVQRSP
SAETALLRSSATGTPVADEPTIDLGSYHHGPSRVSKARPAHHHYPAHHIVPSGEQRVVNYGPPRSKVAPFDVEPQ
VSSAGDHEEIQFASGSSTAVSDAYDPRPKDSPLRIMVDSVLSQAPSFRGRPKVQPIAEDSEKEHIGSDSDASNAF
QWAAPRHVFNLSASKVRPFLSSLTGSDAASPYGRHSKARPMAGSYSPARRSPSESTDSSDTPDEPEHHQKLHVPV
AKVRPFADDTFDAANHPKIHHHFSKVQPFSDSPSAFPSQSALDQCETCNATGQPRDEPRGDSEMASAARQAGERD
GGEDSRLLPDTAPSKHSISADVKYPRGGGKNVGLLLDTAPSKHSISTDVKYPTWTRPQTHSISLCGQDGKPLRGE
TSETSRRPSFRKTPVPFLKSHKRESVDRASSPAEVGSPLFVAKSSEDEEAPADQHSRGFVPTVVFGGRPSKDEAG
GRRASSPAGAVIHAPVPISKVRPHFQEHVFEMDARHHPVSKVRVADTGAAPAAAQREGSESTEGDLEAGIKPNAR
SGRSQSWGSVIDYRSTIQWLKDVLMHRDSNSTRFTERPSKTEEGCASSPETRRHSENLFASIKAARRLSEKTVVR
SGDNNVRFDGHGFKRTVSDIERLLNEALSIASQVVDRPGEDEPRKEPQAGRPKCRHAATDSGLHKRPRLHDIIQS
YSGEGVDLKMRDAYPREAGEAFLSPKIPNRGSSKNPRACVDPRAHTDRMPGRRARPTDKVAMQSLTGHRHGQGRV
VDKKISKGAACDAHGGPENEEEAAAPPKEENTGRPRHGISLRRRSHVSLRGAAGFNLAKSRKRQPTARDWSPVRK
RFVAAVACISTALVGVILGIYAGLVPSIQYYIIDQSHATVHGNTGCFLGLAVPTLFFWPLPLLHGRKPYILLSLV
VAMPLLFPQALAVNSQRLTKTQSWRAMLLASRTLMGVALGFASMNFHSTLLDLFGASLMSVNPHQEVVDEYDARR
HGGGMGAWIGIWTWCWIGSLGVGFLVGACIIDNYPPAWGFYISIIILAVVLFLNVVCPEVRRSAFRRSIVEVRTG
GEVSRRIARGEIMMHRVKTGPKWWGQEVYHGMALSAEMMRQPGFAVLTLYSAWIYAQVVLIMVLLGSLTSRLYQL
RSPAVGLLVASAAAGAGLAIPFQKANVFSRSRLEQMNTNLATLNRRVAWSSHLVRRTVFTLLLPLAGICYAAVSS
GPPMHVSVPTLFAASVGFLSCLAIAECNGLVMETFDCSDLSSGMVGRQRDATGRTQKRTNYSSFPRVTAGFAAIH
GLAFVLAAGATALGGLVTRTLGQQLSTGLAAGILLLLTLLLLLVLIRFSEVQIIPQCKAEAMDRLVEVRRRSSTR
RASMPNDARAIMEEEQAWQPCMIGNPTGKKRRMNVLELGGLTRWQEIRKKNRLIDANAHLNRQAWDQGLEALDDQ
LSDLQRDARDFFQGSARRSRRARRTDDGSGTADESFEMEAAGGLHGRYPERECVMSQTVGEESDGDEEETLGRRR
*
Coding >Ophun1|2758
ATGGAAGCTGGCGATTTCGATGAGACGCCGGCCCCCAGTGGCCGCCCCTCCATGTCTGAGCTGCGGACTGATGGC
GACGACGGCTCTGTGAGAGAGATCGATAGAGGCTCGGGGCCTCGACATCACTTGTTGAAGACGTCGACCAGTGGC
TCCATTCTCGTTGATGGAGACGAGCTCGTATCTACGCCCCGGACTCGACAGCAGGCTTCCAAGGCGTTCAAGGCT
CTTTTGCCGCTTCAGGTGTCTACGGTGTCCCCGGAGAACAAGGTCGCCTCACCCATGACGCCATCCTCTCCGGTC
CGGACCGCGTTTGGCAACCTCTTGTCCGACCGCGCCACGAACCGTCCTCTTCGGCAGCCTGATCCACCGACCGTC
GCCCAAGACCGCCATCAAGAGGTTGACGTGCCGGACGAACGTGGGTTTCGACAGTTTGACGTTCAGCGCTCGCCG
TCTGCGGAGACGGCGCTTTTGCGGTCATCAGCTACGGGAACCCCGGTGGCCGACGAGCCTACGATTGATCTTGGC
TCCTACCATCACGGACCCAGTCGCGTGTCCAAGGCCCGTCCGGCCCATCACCATTATCCTGCTCATCACATTGTT
CCGTCCGGCGAGCAACGAGTCGTCAACTATGGACCACCACGCAGCAAAGTTGCCCCCTTCGACGTTGAGCCTCAA
GTCAGTTCCGCGGGGGACCATGAAGAGATCCAGTTTGCCTCCGGCTCCTCCACGGCTGTCTCAGATGCATACGAC
CCTCGACCGAAAGACAGTCCGCTCCGGATCATGGTGGATTCCGTCTTGTCTCAAGCTCCGTCGTTTCGTGGCCGC
CCCAAGGTTCAACCCATTGCTGAAGATTCGGAAAAGGAGCACATTGGCAGTGACAGTGATGCGTCCAACGCTTTT
CAGTGGGCCGCACCGAGACACGTCTTCAACTTATCCGCGTCAAAGGTTCGACCGTTTCTGTCGTCTCTCACGGGG
TCCGACGCAGCATCCCCGTACGGCCGTCACAGCAAAGCCAGACCCATGGCGGGCTCCTACAGCCCTGCGAGGCGA
TCACCGAGCGAGAGCACTGACAGCTCAGATACCCCTGATGAGCCTGAACATCACCAGAAGCTGCATGTTCCCGTC
GCCAAAGTGAGGCCCTTTGCGGACGACACGTTTGACGCTGCCAATCACCCAAAGATACATCATCATTTTTCAAAA
GTGCAGCCCTTTTCGGACTCGCCGTCTGCCTTTCCATCGCAGAGTGCCCTGGATCAATGTGAGACGTGCAACGCC
ACGGGTCAGCCCAGAGACGAGCCTCGCGGAGATAGCGAGATGGCCTCTGCCGCGCGTCAGGCTGGAGAGCGTGAC
GGAGGTGAAGATTCGAGGCTGCTTCCGGACACGGCGCCCAGCAAGCACTCCATCTCTGCCGATGTCAAGTATCCA
CGCGGCGGCGGAAAGAATGTCGGCCTTCTTCTGGACACGGCGCCCAGCAAGCACTCCATCTCTACCGACGTCAAG
TATCCCACGTGGACCCGACCGCAGACTCATTCCATCAGCCTGTGTGGTCAGGACGGAAAGCCCTTGCGAGGTGAA
ACTTCGGAGACCAGCCGGCGGCCCAGCTTTCGCAAGACGCCAGTCCCTTTTCTCAAGAGCCATAAACGCGAGAGC
GTCGACAGGGCCTCGTCACCGGCTGAAGTGGGCAGTCCTCTGTTTGTCGCCAAGAGCTCCGAAGACGAAGAGGCG
CCTGCGGATCAGCACTCTCGGGGGTTCGTCCCAACCGTCGTGTTCGGTGGCAGACCATCAAAGGACGAGGCTGGA
GGGAGGCGGGCCTCTAGCCCTGCGGGTGCCGTCATCCATGCGCCGGTCCCCATCTCCAAGGTCCGTCCTCACTTT
CAGGAGCACGTTTTCGAGATGGACGCACGCCATCACCCAGTGTCCAAGGTGAGGGTGGCAGACACCGGCGCTGCT
CCCGCGGCGGCTCAACGCGAAGGCTCCGAAAGCACAGAAGGCGACCTGGAGGCCGGCATCAAGCCCAATGCGCGT
TCCGGGCGCAGCCAGTCGTGGGGTTCCGTCATCGACTACAGGAGCACCATCCAGTGGCTCAAGGACGTGCTGATG
CACCGCGATTCGAACTCGACGAGGTTCACGGAGCGGCCCAGCAAGACGGAAGAGGGCTGCGCTTCCTCGCCCGAG
ACGAGGAGACATTCGGAAAACTTGTTTGCCAGCATCAAGGCCGCTCGTCGTCTGAGCGAAAAGACTGTGGTACGG
AGCGGAGACAACAACGTGCGCTTCGACGGACACGGCTTCAAGCGGACCGTCAGCGACATTGAGAGGCTGCTCAAC
GAAGCCCTTTCCATCGCCTCCCAGGTCGTCGACCGCCCCGGTGAAGACGAGCCGAGAAAAGAGCCTCAAGCGGGA
AGGCCGAAATGCCGCCATGCAGCCACAGACTCGGGTCTGCACAAACGGCCACGACTGCACGACATTATCCAGAGC
TACTCGGGCGAGGGCGTCGACCTCAAGATGCGGGATGCGTATCCGCGCGAAGCTGGCGAGGCTTTCCTGTCTCCC
AAGATACCCAACCGGGGGTCCAGCAAGAACCCGAGGGCGTGTGTCGATCCCAGGGCTCACACGGACCGGATGCCT
GGAAGACGAGCGCGTCCGACGGACAAGGTGGCCATGCAGTCGCTGACTGGTCACCGCCACGGTCAGGGACGGGTT
GTCGACAAGAAGATCAGCAAGGGCGCCGCCTGTGACGCCCACGGCGGTCCAGAGAATGAAGAAGAGGCCGCGGCG
CCGCCCAAAGAAGAGAATACCGGTCGTCCGAGACACGGCATCAGCCTGCGCCGGCGTTCCCATGTCAGCCTGCGC
GGAGCTGCCGGCTTCAACCTGGCCAAGTCGCGGAAGCGGCAGCCCACGGCTCGAGACTGGTCCCCCGTCCGCAAG
AGGTTCGTGGCGGCCGTGGCCTGCATCAGCACGGCGCTCGTGGGCGTGATCCTGGGCATCTACGCAGGCCTCGTG
CCGTCGATCCAGTACTACATCATCGACCAGTCTCACGCGACGGTTCACGGCAACACGGGATGCTTCCTGGGCCTG
GCGGTGCCGACGCTGTTCTTCTGGCCGCTGCCGCTGCTGCACGGACGCAAGCCGTACATCTTGCTGAGCCTGGTG
GTGGCGATGCCGCTGCTTTTCCCGCAGGCGCTAGCCGTCAACTCGCAGAGACTCACCAAGACGCAGTCGTGGAGG
GCCATGCTGCTGGCATCGCGGACTCTGATGGGCGTCGCGCTCGGGTTCGCGAGCATGAACTTCCACTCGACGCTG
CTGGACCTGTTTGGGGCGTCGCTGATGAGCGTCAACCCGCACCAGGAGGTGGTGGACGAGTACGACGCTCGGAGG
CACGGCGGCGGCATGGGCGCGTGGATCGGCATCTGGACGTGGTGCTGGATCGGATCACTGGGCGTTGGCTTCCTG
GTGGGCGCGTGCATCATCGACAACTACCCGCCAGCCTGGGGCTTCTACATCAGCATCATCATCCTGGCCGTGGTG
CTCTTCCTCAACGTGGTGTGTCCGGAGGTTCGGCGGTCGGCCTTTCGGCGGTCCATTGTCGAGGTCCGGACCGGG
GGAGAAGTGTCACGACGCATCGCCCGGGGCGAGATCATGATGCACCGCGTCAAGACGGGGCCCAAGTGGTGGGGA
CAGGAGGTGTATCACGGCATGGCGCTGTCGGCCGAGATGATGCGGCAGCCGGGATTCGCGGTGCTGACGCTGTAC
TCTGCCTGGATCTACGCCCAAGTTGTGCTCATCATGGTGCTGCTGGGATCGCTGACGTCGCGGCTGTACCAGCTG
CGGTCTCCGGCCGTGGGCCTGCTGGTTGCCTCGGCGGCGGCCGGAGCCGGGCTGGCGATTCCCTTTCAAAAGGCC
AACGTCTTCTCGCGCTCGCGGCTGGAGCAGATGAACACGAACCTGGCGACGCTGAACCGACGAGTGGCATGGTCG
TCTCACCTGGTACGGCGCACCGTCTTTACGCTGCTGCTGCCGCTGGCCGGCATCTGCTACGCGGCCGTGTCGTCC
GGTCCTCCGATGCACGTCAGCGTCCCGACGCTCTTCGCCGCCTCGGTCGGCTTCCTGTCGTGTCTGGCCATCGCC
GAGTGCAACGGGCTGGTGATGGAGACGTTTGACTGCTCCGACCTGTCCTCGGGCATGGTGGGACGGCAACGGGAC
GCGACGGGCAGGACGCAGAAGCGGACCAATTACTCTTCGTTCCCACGCGTCACGGCCGGATTCGCCGCCATCCAC
GGGCTCGCCTTTGTGCTGGCGGCCGGGGCCACGGCTCTGGGAGGGCTGGTGACGCGGACGCTGGGCCAGCAGCTG
TCGACGGGGTTGGCGGCGGGCATCCTGCTGCTGCTGACGCTGCTGCTGCTCCTGGTCCTGATACGCTTCAGCGAG
GTGCAAATCATCCCGCAGTGCAAGGCCGAGGCCATGGACCGGCTGGTCGAGGTACGGCGCCGGTCGAGCACGCGA
CGGGCTTCGATGCCCAACGACGCGAGGGCCATCATGGAGGAGGAGCAGGCGTGGCAGCCGTGCATGATTGGCAAC
CCGACGGGGAAGAAGCGGCGGATGAACGTGCTGGAGCTCGGCGGCCTGACGCGGTGGCAGGAGATACGCAAGAAG
AACCGGCTCATCGACGCCAACGCGCACCTGAACCGGCAGGCCTGGGATCAGGGCCTCGAGGCTCTCGACGATCAG
CTCAGCGACCTGCAGAGGGACGCGCGGGACTTCTTCCAGGGGAGCGCACGGCGGTCGAGGCGGGCGCGGCGGACC
GACGACGGCAGCGGGACGGCGGACGAGTCGTTCGAGATGGAGGCTGCCGGCGGACTGCACGGTCGGTATCCGGAG
AGAGAGTGCGTCATGAGCCAGACGGTGGGAGAGGAGAGCGACGGGGACGAAGAAGAGACCTTGGGGCGACGGCGG
TGA
Transcript >Ophun1|2758
ATGGAAGCTGGCGATTTCGATGAGACGCCGGCCCCCAGTGGCCGCCCCTCCATGTCTGAGCTGCGGACTGATGGC
GACGACGGCTCTGTGAGAGAGATCGATAGAGGCTCGGGGCCTCGACATCACTTGTTGAAGACGTCGACCAGTGGC
TCCATTCTCGTTGATGGAGACGAGCTCGTATCTACGCCCCGGACTCGACAGCAGGCTTCCAAGGCGTTCAAGGCT
CTTTTGCCGCTTCAGGTGTCTACGGTGTCCCCGGAGAACAAGGTCGCCTCACCCATGACGCCATCCTCTCCGGTC
CGGACCGCGTTTGGCAACCTCTTGTCCGACCGCGCCACGAACCGTCCTCTTCGGCAGCCTGATCCACCGACCGTC
GCCCAAGACCGCCATCAAGAGGTTGACGTGCCGGACGAACGTGGGTTTCGACAGTTTGACGTTCAGCGCTCGCCG
TCTGCGGAGACGGCGCTTTTGCGGTCATCAGCTACGGGAACCCCGGTGGCCGACGAGCCTACGATTGATCTTGGC
TCCTACCATCACGGACCCAGTCGCGTGTCCAAGGCCCGTCCGGCCCATCACCATTATCCTGCTCATCACATTGTT
CCGTCCGGCGAGCAACGAGTCGTCAACTATGGACCACCACGCAGCAAAGTTGCCCCCTTCGACGTTGAGCCTCAA
GTCAGTTCCGCGGGGGACCATGAAGAGATCCAGTTTGCCTCCGGCTCCTCCACGGCTGTCTCAGATGCATACGAC
CCTCGACCGAAAGACAGTCCGCTCCGGATCATGGTGGATTCCGTCTTGTCTCAAGCTCCGTCGTTTCGTGGCCGC
CCCAAGGTTCAACCCATTGCTGAAGATTCGGAAAAGGAGCACATTGGCAGTGACAGTGATGCGTCCAACGCTTTT
CAGTGGGCCGCACCGAGACACGTCTTCAACTTATCCGCGTCAAAGGTTCGACCGTTTCTGTCGTCTCTCACGGGG
TCCGACGCAGCATCCCCGTACGGCCGTCACAGCAAAGCCAGACCCATGGCGGGCTCCTACAGCCCTGCGAGGCGA
TCACCGAGCGAGAGCACTGACAGCTCAGATACCCCTGATGAGCCTGAACATCACCAGAAGCTGCATGTTCCCGTC
GCCAAAGTGAGGCCCTTTGCGGACGACACGTTTGACGCTGCCAATCACCCAAAGATACATCATCATTTTTCAAAA
GTGCAGCCCTTTTCGGACTCGCCGTCTGCCTTTCCATCGCAGAGTGCCCTGGATCAATGTGAGACGTGCAACGCC
ACGGGTCAGCCCAGAGACGAGCCTCGCGGAGATAGCGAGATGGCCTCTGCCGCGCGTCAGGCTGGAGAGCGTGAC
GGAGGTGAAGATTCGAGGCTGCTTCCGGACACGGCGCCCAGCAAGCACTCCATCTCTGCCGATGTCAAGTATCCA
CGCGGCGGCGGAAAGAATGTCGGCCTTCTTCTGGACACGGCGCCCAGCAAGCACTCCATCTCTACCGACGTCAAG
TATCCCACGTGGACCCGACCGCAGACTCATTCCATCAGCCTGTGTGGTCAGGACGGAAAGCCCTTGCGAGGTGAA
ACTTCGGAGACCAGCCGGCGGCCCAGCTTTCGCAAGACGCCAGTCCCTTTTCTCAAGAGCCATAAACGCGAGAGC
GTCGACAGGGCCTCGTCACCGGCTGAAGTGGGCAGTCCTCTGTTTGTCGCCAAGAGCTCCGAAGACGAAGAGGCG
CCTGCGGATCAGCACTCTCGGGGGTTCGTCCCAACCGTCGTGTTCGGTGGCAGACCATCAAAGGACGAGGCTGGA
GGGAGGCGGGCCTCTAGCCCTGCGGGTGCCGTCATCCATGCGCCGGTCCCCATCTCCAAGGTCCGTCCTCACTTT
CAGGAGCACGTTTTCGAGATGGACGCACGCCATCACCCAGTGTCCAAGGTGAGGGTGGCAGACACCGGCGCTGCT
CCCGCGGCGGCTCAACGCGAAGGCTCCGAAAGCACAGAAGGCGACCTGGAGGCCGGCATCAAGCCCAATGCGCGT
TCCGGGCGCAGCCAGTCGTGGGGTTCCGTCATCGACTACAGGAGCACCATCCAGTGGCTCAAGGACGTGCTGATG
CACCGCGATTCGAACTCGACGAGGTTCACGGAGCGGCCCAGCAAGACGGAAGAGGGCTGCGCTTCCTCGCCCGAG
ACGAGGAGACATTCGGAAAACTTGTTTGCCAGCATCAAGGCCGCTCGTCGTCTGAGCGAAAAGACTGTGGTACGG
AGCGGAGACAACAACGTGCGCTTCGACGGACACGGCTTCAAGCGGACCGTCAGCGACATTGAGAGGCTGCTCAAC
GAAGCCCTTTCCATCGCCTCCCAGGTCGTCGACCGCCCCGGTGAAGACGAGCCGAGAAAAGAGCCTCAAGCGGGA
AGGCCGAAATGCCGCCATGCAGCCACAGACTCGGGTCTGCACAAACGGCCACGACTGCACGACATTATCCAGAGC
TACTCGGGCGAGGGCGTCGACCTCAAGATGCGGGATGCGTATCCGCGCGAAGCTGGCGAGGCTTTCCTGTCTCCC
AAGATACCCAACCGGGGGTCCAGCAAGAACCCGAGGGCGTGTGTCGATCCCAGGGCTCACACGGACCGGATGCCT
GGAAGACGAGCGCGTCCGACGGACAAGGTGGCCATGCAGTCGCTGACTGGTCACCGCCACGGTCAGGGACGGGTT
GTCGACAAGAAGATCAGCAAGGGCGCCGCCTGTGACGCCCACGGCGGTCCAGAGAATGAAGAAGAGGCCGCGGCG
CCGCCCAAAGAAGAGAATACCGGTCGTCCGAGACACGGCATCAGCCTGCGCCGGCGTTCCCATGTCAGCCTGCGC
GGAGCTGCCGGCTTCAACCTGGCCAAGTCGCGGAAGCGGCAGCCCACGGCTCGAGACTGGTCCCCCGTCCGCAAG
AGGTTCGTGGCGGCCGTGGCCTGCATCAGCACGGCGCTCGTGGGCGTGATCCTGGGCATCTACGCAGGCCTCGTG
CCGTCGATCCAGTACTACATCATCGACCAGTCTCACGCGACGGTTCACGGCAACACGGGATGCTTCCTGGGCCTG
GCGGTGCCGACGCTGTTCTTCTGGCCGCTGCCGCTGCTGCACGGACGCAAGCCGTACATCTTGCTGAGCCTGGTG
GTGGCGATGCCGCTGCTTTTCCCGCAGGCGCTAGCCGTCAACTCGCAGAGACTCACCAAGACGCAGTCGTGGAGG
GCCATGCTGCTGGCATCGCGGACTCTGATGGGCGTCGCGCTCGGGTTCGCGAGCATGAACTTCCACTCGACGCTG
CTGGACCTGTTTGGGGCGTCGCTGATGAGCGTCAACCCGCACCAGGAGGTGGTGGACGAGTACGACGCTCGGAGG
CACGGCGGCGGCATGGGCGCGTGGATCGGCATCTGGACGTGGTGCTGGATCGGATCACTGGGCGTTGGCTTCCTG
GTGGGCGCGTGCATCATCGACAACTACCCGCCAGCCTGGGGCTTCTACATCAGCATCATCATCCTGGCCGTGGTG
CTCTTCCTCAACGTGGTGTGTCCGGAGGTTCGGCGGTCGGCCTTTCGGCGGTCCATTGTCGAGGTCCGGACCGGG
GGAGAAGTGTCACGACGCATCGCCCGGGGCGAGATCATGATGCACCGCGTCAAGACGGGGCCCAAGTGGTGGGGA
CAGGAGGTGTATCACGGCATGGCGCTGTCGGCCGAGATGATGCGGCAGCCGGGATTCGCGGTGCTGACGCTGTAC
TCTGCCTGGATCTACGCCCAAGTTGTGCTCATCATGGTGCTGCTGGGATCGCTGACGTCGCGGCTGTACCAGCTG
CGGTCTCCGGCCGTGGGCCTGCTGGTTGCCTCGGCGGCGGCCGGAGCCGGGCTGGCGATTCCCTTTCAAAAGGCC
AACGTCTTCTCGCGCTCGCGGCTGGAGCAGATGAACACGAACCTGGCGACGCTGAACCGACGAGTGGCATGGTCG
TCTCACCTGGTACGGCGCACCGTCTTTACGCTGCTGCTGCCGCTGGCCGGCATCTGCTACGCGGCCGTGTCGTCC
GGTCCTCCGATGCACGTCAGCGTCCCGACGCTCTTCGCCGCCTCGGTCGGCTTCCTGTCGTGTCTGGCCATCGCC
GAGTGCAACGGGCTGGTGATGGAGACGTTTGACTGCTCCGACCTGTCCTCGGGCATGGTGGGACGGCAACGGGAC
GCGACGGGCAGGACGCAGAAGCGGACCAATTACTCTTCGTTCCCACGCGTCACGGCCGGATTCGCCGCCATCCAC
GGGCTCGCCTTTGTGCTGGCGGCCGGGGCCACGGCTCTGGGAGGGCTGGTGACGCGGACGCTGGGCCAGCAGCTG
TCGACGGGGTTGGCGGCGGGCATCCTGCTGCTGCTGACGCTGCTGCTGCTCCTGGTCCTGATACGCTTCAGCGAG
GTGCAAATCATCCCGCAGTGCAAGGCCGAGGCCATGGACCGGCTGGTCGAGGTACGGCGCCGGTCGAGCACGCGA
CGGGCTTCGATGCCCAACGACGCGAGGGCCATCATGGAGGAGGAGCAGGCGTGGCAGCCGTGCATGATTGGCAAC
CCGACGGGGAAGAAGCGGCGGATGAACGTGCTGGAGCTCGGCGGCCTGACGCGGTGGCAGGAGATACGCAAGAAG
AACCGGCTCATCGACGCCAACGCGCACCTGAACCGGCAGGCCTGGGATCAGGGCCTCGAGGCTCTCGACGATCAG
CTCAGCGACCTGCAGAGGGACGCGCGGGACTTCTTCCAGGGGAGCGCACGGCGGTCGAGGCGGGCGCGGCGGACC
GACGACGGCAGCGGGACGGCGGACGAGTCGTTCGAGATGGAGGCTGCCGGCGGACTGCACGGTCGGTATCCGGAG
AGAGAGTGCGTCATGAGCCAGACGGTGGGAGAGGAGAGCGACGGGGACGAAGAAGAGACCTTGGGGCGACGGCGG
TGA
Gene >Ophun1|2758
ATGGAAGCTGGCGATTTCGATGAGACGCCGGCCCCCAGTGGCCGCCCCTCCATGTCTGAGCTGCGGACTGATGGC
GACGACGGCTCTGTGAGAGAGATCGATAGAGGCTCGGGGCCTCGACATCACTTGTTGAAGACGTCGACCAGTGGC
TCCATTCTCGTTGATGGAGACGAGCTCGTATCTACGCCCCGGACTCGACAGCAGGCTTCCAAGGCGTTCAAGGCT
CTTTTGCCGCTTCAGGTGTCTACGGTGTCCCCGGAGAACAAGGTCGCCTCACCCATGACGCCATCCTCTCCGGTC
CGGACCGCGTTTGGCAACCTCTTGTCCGACCGCGCCACGAACCGTCCTCTTCGGCAGCCTGATCCACCGACCGTC
GCCCAAGACCGCCATCAAGAGGTTGACGTGCCGGACGAACGTGGGTTTCGACAGTTTGACGTTCAGCGCTCGCCG
TCTGCGGAGACGGCGCTTTTGCGGTCATCAGCTACGGGAACCCCGGTGGCCGACGAGCCTACGATTGATCTTGGC
TCCTACCATCACGGACCCAGTCGCGTGTCCAAGGCCCGTCCGGCCCATCACCATTATCCTGCTCATCACATTGTT
CCGTCCGGCGAGCAACGAGTCGTCAACTATGGACCACCACGCAGCAAAGTTGCCCCCTTCGACGTTGAGCCTCAA
GTCAGTTCCGCGGGGGACCATGAAGAGATCCAGTTTGCCTCCGGCTCCTCCACGGCTGTCTCAGATGCATACGAC
CCTCGACCGAAAGACAGTCCGCTCCGGATCATGGTGGATTCCGTCTTGTCTCAAGCTCCGTCGTTTCGTGGCCGC
CCCAAGGTTCAACCCATTGCTGAAGATTCGGAAAAGGAGCACATTGGCAGTGACAGTGATGCGTCCAACGCTTTT
CAGTGGGCCGCACCGAGACACGTCTTCAACTTATCCGCGTCAAAGGTTCGACCGTTTCTGTCGTCTCTCACGGGG
TCCGACGCAGCATCCCCGTACGGCCGTCACAGCAAAGCCAGACCCATGGCGGGCTCCTACAGCCCTGCGAGGCGA
TCACCGAGCGAGAGCACTGACAGCTCAGATACCCCTGATGAGCCTGAACATCACCAGAAGCTGCATGTTCCCGTC
GCCAAAGTGAGGCCCTTTGCGGACGACACGTTTGACGCTGCCAATCACCCAAAGATACATCATCATTTTTCAAAA
GTGCAGCCCTTTTCGGACTCGCCGTCTGCCTTTCCATCGCAGAGTGCCCTGGATCAATGTGAGACGTGCAACGCC
ACGGGTCAGCCCAGAGACGAGCCTCGCGGAGATAGCGAGATGGCCTCTGCCGCGCGTCAGGCTGGAGAGCGTGAC
GGAGGTGAAGATTCGAGGCTGCTTCCGGACACGGCGCCCAGCAAGCACTCCATCTCTGCCGATGTCAAGTATCCA
CGCGGCGGCGGAAAGAATGTCGGCCTTCTTCTGGACACGGCGCCCAGCAAGCACTCCATCTCTACCGACGTCAAG
TATCCCACGTGGACCCGACCGCAGACTCATTCCATCAGCCTGTGTGGTCAGGACGGAAAGCCCTTGCGAGGTGAA
ACTTCGGAGACCAGCCGGCGGCCCAGCTTTCGCAAGACGCCAGTCCCTTTTCTCAAGAGCCATAAACGCGAGAGC
GTCGACAGGGCCTCGTCACCGGCTGAAGTGGGCAGTCCTCTGTTTGTCGCCAAGAGCTCCGAAGACGAAGAGGCG
CCTGCGGATCAGCACTCTCGGGGGTTCGTCCCAACCGTCGTGTTCGGTGGCAGACCATCAAAGGACGAGGCTGGA
GGGAGGCGGGCCTCTAGCCCTGCGGGTGCCGTCATCCATGCGCCGGTCCCCATCTCCAAGGTCCGTCCTCACTTT
CAGGAGCACGTTTTCGAGATGGACGCACGCCATCACCCAGTGTCCAAGGTGAGGGTGGCAGACACCGGCGCTGCT
CCCGCGGCGGCTCAACGCGAAGGCTCCGAAAGCACAGAAGGCGACCTGGAGGCCGGCATCAAGCCCAATGCGCGT
TCCGGGCGCAGCCAGTCGTGGGGTTCCGTCATCGACTACAGGAGCACCATCCAGTGGCTCAAGGACGTGCTGATG
CACCGCGATTCGAACTCGACGAGGTTCACGGAGCGGCCCAGCAAGACGGAAGAGGGCTGCGCTTCCTCGCCCGAG
ACGAGGAGACATTCGGAAAACTTGTTTGCCAGCATCAAGGCCGCTCGTCGTCTGAGCGAAAAGACTGTGGTACGG
AGCGGAGACAACAACGTGCGCTTCGACGGACACGGCTTCAAGCGGACCGTCAGCGACATTGAGAGGCTGCTCAAC
GAAGCCCTTTCCATCGCCTCCCAGGTCGTCGACCGCCCCGGTGAAGACGAGCCGAGAAAAGAGCCTCAAGCGGGA
AGGCCGAAATGCCGCCATGCAGCCACAGACTCGGGTCTGCACAAACGGCCACGACTGCACGACATTATCCAGAGC
TACTCGGGCGAGGGCGTCGACCTCAAGATGCGGGATGCGTATCCGCGCGAAGCTGGCGAGGCTTTCCTGTCTCCC
AAGATACCCAACCGGGGGTCCAGCAAGAACCCGAGGGCGTGTGTCGATCCCAGGGCTCACACGGACCGGATGCCT
GGAAGACGAGCGCGTCCGACGGACAAGGTGGCCATGCAGTCGCTGACTGGTCACCGCCACGGTCAGGGACGGGTT
GTCGACAAGAAGATCAGCAAGGGCGCCGCCTGTGACGCCCACGGCGGTCCAGAGAATGAAGAAGAGGCCGCGGCG
CCGCCCAAAGAAGAGAATACCGGTCGTCCGAGACACGGCATCAGCCTGCGCCGGCGTTCCCATGTCAGCCTGCGC
GGAGCTGCCGGCTTCAACCTGGCCAAGTCGCGGAAGCGGCAGCCCACGGCTCGAGACTGGTCCCCCGTCCGCAAG
AGGTTCGTGGCGGCCGTGGCCTGCATCAGCACGGCGCTCGTGGGCGTGATCCTGGGCATCTACGCAGGCCTCGTG
CCGTCGATCCAGTACTACATCATCGACCAGTCTCACGCGACGGTTCACGGCAACACGGGATGCTTCCTGGGCCTG
GCGGTGCCGACGCTGTTCTTCTGGCCGCTGCCGCTGCTGCACGGACGCAAGCCGTACATCTTGCTGAGCCTGGTG
GTGGCGATGCCGCTGCTTTTCCCGCAGGCGCTAGCCGTCAACTCGCAGAGACTCACCAAGACGCAGTCGTGGAGG
GCCATGCTGCTGGCATCGCGGACTCTGATGGGCGTCGCGCTCGGGTTCGCGAGCATGAACTTCCACTCGACGCTG
CTGGACCTGTTTGGGGCGTCGCTGATGAGCGTCAACCCGCACCAGGAGGTGGTGGACGAGTACGACGCTCGGAGG
CACGGCGGCGGCATGGGCGCGTGGATCGGCATCTGGACGTGGTGCTGGATCGGATCACTGGGCGTTGGCTTCCTG
GTGGGCGCGTGCATCATCGACAACTACCCGCCAGCCTGGGGCTTCTACATCAGCATCATCATCCTGGCCGTGGTG
CTCTTCCTCAACGTGGTGTGTCCGGAGGTTCGGCGGTCGGCCTTTCGGCGGTCCATTGTCGAGGTCCGGACCGGG
GGAGAAGTGTCACGACGCATCGCCCGGGGCGAGATCATGATGCACCGCGTCAAGACGGGGCCCAAGTGGTGGGGA
CAGGAGGTGTATCACGGCATGGCGCTGTCGGCCGAGATGATGCGGCAGCCGGGATTCGCGGTGCTGACGCTGTAC
TCTGCCTGGATCTACGCCCAAGTTGTGCTCATCATGGTGCTGCTGGGATCGCTGACGTCGCGGCTGTACCAGCTG
CGGTCTCCGGCCGTGGGCCTGCTGGTTGCCTCGGCGGCGGCCGGAGCCGGGCTGGCGATTCCCTTTCAAAAGGCC
AACGTCTTCTCGCGCTCGCGGCTGGAGCAGATGAACACGAACCTGGCGACGCTGAACCGACGAGTGGCATGGTCG
TCTCACCTGGTACGGCGCACCGTCTTTACGCTGCTGCTGCCGCTGGCCGGCATCTGCTACGCGGCCGTGTCGTCC
GGTCCTCCGATGCACGTCAGCGTCCCGACGCTCTTCGCCGCCTCGGTCGGCTTCCTGTCGTGTCTGGCCATCGCC
GAGTGCAACGGGCTGGTGATGGAGACGTTTGACTGCTCCGACCTGTCCTCGGGCATGGTGGGACGGCAACGGGAC
GCGACGGGCAGGACGCAGAAGCGGACCAATTACTCTTCGTTCCCACGCGTCACGGCCGGATTCGCCGCCATCCAC
GGGCTCGCCTTTGTGCTGGCGGCCGGGGCCACGGCTCTGGGAGGGCTGGTGACGCGGACGCTGGGCCAGCAGCTG
TCGACGGGGTTGGCGGCGGGCATCCTGCTGCTGCTGACGCTGCTGCTGCTCCTGGTCCTGATACGCTTCAGCGAG
GTGCAAATCATCCCGCAGTGCAAGGCCGAGGCCATGGACCGGCTGGTCGAGGTACGGCGCCGGTCGAGCACGCGA
CGGGCTTCGATGCCCAACGACGCGAGGGCCATCATGGAGGAGGAGCAGGCGTGGCAGCCGTGCATGATTGGCAAC
CCGACGGGGAAGAAGCGGCGGATGAACGTGCTGGAGCTCGGCGGCCTGACGCGGTGGCAGGAGATACGCAAGAAG
AACCGGCTCATCGACGCCAACGCGCACCTGAACCGGCAGGCCTGGGATCAGGGCCTCGAGGCTCTCGACGATCAG
CTCAGCGACCTGCAGAGGGACGCGCGGGACTTCTTCCAGGGGAGCGCACGGCGGTCGAGGCGGGCGCGGCGGACC
GACGACGGCAGCGGGACGGCGGACGAGTCGTTCGAGATGGAGGCTGCCGGCGGACTGCACGGTCGGTATCCGGAG
AGAGAGTGCGTCATGAGCCAGACGGTGGGAGAGGAGAGCGACGGGGACGAAGAAGAGACCTTGGGGCGACGGCGG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail