Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2756
Gene name
LocationContig_245:18444..22134
Strand-
Gene length (bp)3690
Transcript length (bp)3354
Coding sequence length (bp)3354
Protein length (aa) 1118

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12341 Mcl1_mid Minichromosome loss protein, Mcl1, middle region 9.8E-98 530 818
PF00400 WD40 WD domain, G-beta repeat 3.6E-02 126 155
PF00400 WD40 WD domain, G-beta repeat 1.1E-07 344 374
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 3.6E-08 314 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C107|MCL1_SCHPO Minichromosome loss protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcl1 PE=1 SV=1 124 971 8.0E-168
sp|Q01454|CTF4_YEAST DNA polymerase alpha-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTF4 PE=1 SV=2 130 979 3.0E-47
sp|O13046|WDHD1_XENLA WD repeat and HMG-box DNA-binding protein 1 OS=Xenopus laevis GN=wdhd1 PE=1 SV=1 124 980 9.0E-42
sp|O75717|WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens GN=WDHD1 PE=1 SV=1 504 980 4.0E-23
sp|P59328|WDHD1_MOUSE WD repeat and HMG-box DNA-binding protein 1 OS=Mus musculus GN=Wdhd1 PE=1 SV=2 505 971 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C107|MCL1_SCHPO Minichromosome loss protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcl1 PE=1 SV=1 124 971 8.0E-168
sp|Q01454|CTF4_YEAST DNA polymerase alpha-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTF4 PE=1 SV=2 130 979 3.0E-47
sp|O13046|WDHD1_XENLA WD repeat and HMG-box DNA-binding protein 1 OS=Xenopus laevis GN=wdhd1 PE=1 SV=1 124 980 9.0E-42
sp|O75717|WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens GN=WDHD1 PE=1 SV=1 504 980 4.0E-23
sp|P59328|WDHD1_MOUSE WD repeat and HMG-box DNA-binding protein 1 OS=Mus musculus GN=Wdhd1 PE=1 SV=2 505 971 1.0E-19
sp|O75717|WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens GN=WDHD1 PE=1 SV=1 113 411 1.0E-17
sp|P59328|WDHD1_MOUSE WD repeat and HMG-box DNA-binding protein 1 OS=Mus musculus GN=Wdhd1 PE=1 SV=2 113 411 1.0E-16
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 125 393 6.0E-13
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 109 400 7.0E-13
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 116 379 9.0E-13
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 127 377 1.0E-12
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 121 377 2.0E-12
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 121 384 8.0E-12
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 115 393 9.0E-12
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 121 377 1.0E-11
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 121 377 1.0E-11
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 127 385 1.0E-11
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 121 384 1.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 127 382 5.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 127 385 6.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 109 375 1.0E-10
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 125 393 3.0E-10
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 118 380 3.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 127 383 5.0E-10
sp|A7TL57|ATG11_VANPO Autophagy-related protein 11 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG11 PE=3 SV=1 1 75 5.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 131 383 7.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 127 385 8.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 119 378 8.0E-10
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 127 381 8.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 127 385 8.0E-10
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 117 377 2.0E-09
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 127 383 5.0E-09
sp|A7TL57|ATG11_VANPO Autophagy-related protein 11 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG11 PE=3 SV=1 1 80 8.0E-09
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 127 377 9.0E-09
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 119 375 1.0E-08
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 127 393 1.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 127 385 2.0E-08
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 296 436 2.0E-08
sp|Q6FJ73|CIAO1_CANGA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 247 416 2.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 127 383 4.0E-08
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 131 377 6.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 127 375 9.0E-08
sp|O42937|COPB2_SCHPO Probable coatomer subunit beta' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec27 PE=3 SV=2 116 400 1.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 175 382 1.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 127 382 2.0E-07
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 296 450 2.0E-07
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 127 385 2.0E-07
sp|A7TL57|ATG11_VANPO Autophagy-related protein 11 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG11 PE=3 SV=1 3 96 3.0E-07
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 258 416 3.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 116 379 4.0E-07
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 127 383 5.0E-07
sp|Q75C26|CIAO1_ASHGO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIA1 PE=3 SV=1 242 443 5.0E-07
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 246 398 5.0E-07
sp|Q0USG2|CIAO1_PHANO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CIA1 PE=3 SV=1 263 416 8.0E-07
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 126 393 8.0E-07
sp|Q05583|CIAO1_YEAST Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 174 375 9.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 127 378 9.0E-07
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 143 416 1.0E-06
sp|A6ZYM0|CIAO1_YEAS7 Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 174 375 1.0E-06
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 126 393 1.0E-06
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 143 416 1.0E-06
sp|Q06078|UTP21_YEAST U3 small nucleolar RNA-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP21 PE=1 SV=1 214 382 1.0E-06
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 116 373 1.0E-06
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 192 411 2.0E-06
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 126 394 2.0E-06
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 143 416 2.0E-06
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 146 396 2.0E-06
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 302 416 3.0E-06
sp|A2RRU3|UTP15_RAT U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 183 388 3.0E-06
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 183 382 3.0E-06
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 214 389 3.0E-06
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 259 413 3.0E-06
sp|Q8C7V3|UTP15_MOUSE U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 183 388 3.0E-06
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 127 383 4.0E-06
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 119 377 4.0E-06
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 130 375 4.0E-06
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 153 416 5.0E-06
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 119 369 5.0E-06
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 243 433 5.0E-06
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 130 375 6.0E-06
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 302 416 6.0E-06
sp|Q2UPI0|CIAO1_ASPOR Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cia1 PE=3 SV=1 263 403 6.0E-06
sp|B8MWR8|CIAO1_ASPFN Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cia1 PE=3 SV=1 263 403 6.0E-06
sp|A6ZYM0|CIAO1_YEAS7 Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 260 427 8.0E-06
sp|A7TL57|ATG11_VANPO Autophagy-related protein 11 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG11 PE=3 SV=1 1 95 9.0E-06
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 109 375 9.0E-06
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 153 416 9.0E-06
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 183 385 9.0E-06
sp|Q9W328|LST8_DROME Protein LST8 homolog OS=Drosophila melanogaster GN=Lst8 PE=2 SV=2 130 280 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1142
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1611
Ophiocordyceps australis map64 (Brazil) OphauB2|6740
Ophiocordyceps camponoti-floridani Ophcf2|06733
Ophiocordyceps camponoti-rufipedis Ophun1|2756 (this protein)
Ophiocordyceps kimflemingae Ophio5|905
Ophiocordyceps subramaniannii Hirsu2|1021

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2756
MEQAMEQALEQSLEQASEQASEQALEQAPEQSKEQSKEQSKEQSPEQSLEQAPEQSLEQAQEQEEAQTQEEIQTQ
EETQTQEETQTQEETQTQDQDKDEDEEQTQEKKKTSRPADQKPELPRARPAHTHGITRCAYSKNGKRLVSAGSNN
LIRLWTAGPVHSEPLNIDDCQEHNVSISAHHDFFVVGSEDGVVSLYSFERRVFERMLLRTSSPVRDVSLSHDGEW
CAIASDERSVKIVHTKNITRMRHLREHNRASRHVSLDPSSSLAAVSCTDGVVYLYSLTSNKPQLICKIDGVIAAL
KGHSTASYKPVWHPGGSVFALPTPTRDIQVVSRHDGEKQWCFADGHSAEITCLAWSPNGAMLASTSRDGRVLIWE
TETHSVIQRYDFADVVDLTWHVSRNLASFTTLTGEIYFHYEFVPDQFVSLLNLPLQTVPLIERRRAETPHVHEDV
DVPAETVRDLSAPSRQRRESFGSLDSFLDAAADGQAEDDDFVVDDDGAGYATGSKRPWDGEGPSGEQKRINLTRR
QHHEAFQPGSTPWRGNRKYLCLNLIGVVWTVDQDSHHTVTVEFYDRDMQRDFHFTDTFLYDKACLNERGALFSSP
AKDDTPAYIFYRPHESWTQRHDWRTQLPLGEDVVAMSLSESFVTVTTTASYVRVYTLLGMPYRLYRPKSAPVVTC
ASWRDYVMTVGNGPVGADGATRLLYTIENVKRDQICQNEDTVALPQGATLKSVFFSDEGDPCIYDSTGTLLTLLH
WRRPSRASWVPVLDTKLLPRLASGRKHETYFPVALADGKFHCIILKGGEQYPYFPRPLLSEFGLSVPLKSPGQRR
KKNKSKGKVKGTTNGDDEDEFMTKDDDDIFKGDDDSDQEGEEGGEEDERTRLEQQFMLQGVRAAQLRDVVSARPN
SHKQRSQLSRAELEIDKVLLQLLAVECREGEERGMRALEMVALMRDRTGRMMEAAGKVAERYGRTVLGDKIREIG
ERRHAPHPLQTLVLDPHAPLRALLLHHQIQQSRPPVGEVAGVRLQAELAVQEDDGVSRGNEVFCAGGAAGSGAEV
VDEADGLALEGDRCSARGYQGDATGWDGGVVGDEGAGEGGLVVEVGGRGGGGEVGGFCGGGGFWWLS*
Coding >Ophun1|2756
ATGGAGCAGGCAATGGAACAGGCATTGGAGCAGTCACTGGAGCAGGCATCGGAGCAGGCATCGGAGCAGGCACTG
GAGCAGGCACCGGAGCAGTCAAAGGAGCAGTCAAAGGAGCAGTCAAAGGAGCAGTCACCGGAGCAGTCACTGGAG
CAGGCACCGGAGCAGTCACTGGAGCAGGCACAAGAACAGGAAGAGGCACAGACACAGGAAGAGATACAGACCCAG
GAAGAGACACAGACACAGGAAGAGACACAGACACAGGAAGAGACACAGACGCAGGATCAGGATAAGGATGAGGAT
GAGGAACAGACACAGGAAAAGAAAAAGACATCTCGCCCAGCTGATCAGAAACCTGAATTGCCACGGGCTCGTCCA
GCGCATACCCACGGCATAACGCGCTGCGCCTACTCAAAAAACGGCAAACGACTCGTTTCGGCTGGCTCCAACAAC
TTGATTCGGCTATGGACTGCAGGGCCAGTGCATAGCGAGCCTCTCAACATTGACGACTGCCAGGAACACAATGTC
TCCATCTCTGCCCACCACGATTTCTTCGTCGTTGGCTCCGAGGACGGTGTCGTCAGTCTCTACTCGTTCGAGCGC
AGGGTCTTTGAGCGCATGCTACTGCGCACGAGCTCGCCCGTCCGAGACGTGTCCCTTTCCCACGATGGCGAGTGG
TGTGCGATTGCCAGCGACGAGCGGAGCGTCAAGATTGTGCACACCAAGAATATAACCCGGATGCGCCACTTGCGA
GAGCATAACAGGGCCTCGAGACACGTCAGCTTGGACCCAAGCTCCTCTCTGGCCGCCGTCTCGTGCACCGATGGC
GTCGTCTATCTCTATTCCCTGACGTCGAACAAGCCCCAACTGATATGCAAGATCGACGGGGTCATCGCCGCGCTC
AAAGGCCACTCCACCGCATCGTACAAGCCAGTTTGGCATCCTGGAGGCAGCGTGTTTGCCCTTCCGACGCCGACA
AGAGACATCCAGGTCGTGTCCAGGCACGACGGCGAGAAGCAGTGGTGTTTTGCCGACGGGCATTCGGCCGAGATC
ACCTGCCTTGCCTGGTCGCCCAACGGAGCCATGCTGGCCTCGACGAGCAGAGACGGCAGGGTACTCATCTGGGAG
ACCGAGACGCATAGTGTCATCCAACGATATGACTTCGCCGACGTCGTGGACCTGACTTGGCATGTCTCTAGAAAC
CTGGCTTCTTTCACAACGCTCACCGGCGAGATTTACTTCCATTACGAGTTTGTGCCCGATCAATTCGTCTCGTTG
CTCAACCTGCCCCTGCAGACTGTGCCCTTGATCGAAAGACGCCGAGCCGAGACGCCCCATGTCCACGAGGACGTG
GATGTGCCGGCCGAGACGGTCAGGGATTTGAGCGCGCCGAGTCGCCAACGACGCGAGTCCTTCGGCAGCCTGGAC
TCTTTCCTCGACGCTGCCGCAGACGGACAAGCAGAAGATGACGACTTCGTGGTCGACGACGACGGTGCCGGATAC
GCGACGGGAAGCAAGAGACCATGGGACGGCGAAGGCCCTTCAGGGGAGCAAAAACGCATCAATCTCACGAGACGG
CAGCATCACGAAGCCTTTCAGCCCGGATCGACGCCGTGGCGAGGTAACCGCAAGTATCTTTGCCTCAACCTCATC
GGCGTCGTCTGGACCGTTGACCAGGACTCTCACCACACGGTGACGGTCGAGTTTTACGATCGCGACATGCAGCGC
GACTTTCACTTCACCGACACGTTCCTGTACGACAAGGCCTGCCTCAACGAACGCGGCGCCCTGTTCTCGTCGCCG
GCAAAGGACGACACGCCGGCGTACATCTTCTACCGGCCTCACGAGAGCTGGACGCAGCGTCACGACTGGCGTACG
CAGCTGCCGTTGGGCGAGGATGTGGTGGCCATGTCGCTGAGCGAGTCGTTTGTGACGGTGACGACGACGGCGAGC
TACGTGCGGGTGTATACGCTCCTCGGCATGCCCTACCGCCTGTACCGACCCAAGAGCGCGCCCGTGGTGACGTGC
GCGAGCTGGAGGGACTACGTCATGACGGTGGGCAACGGGCCCGTGGGCGCCGACGGCGCGACGCGGCTGTTGTAC
ACGATCGAGAACGTCAAGCGCGACCAGATTTGCCAGAACGAGGATACCGTCGCTCTACCTCAAGGGGCCACGCTC
AAGAGCGTCTTCTTCTCGGACGAGGGGGACCCTTGCATATACGATTCAACGGGAACGCTGCTGACGCTGCTTCAT
TGGCGGCGGCCGTCGCGGGCCTCGTGGGTGCCCGTGCTGGACACGAAGCTGCTGCCTCGACTGGCGTCTGGACGG
AAGCACGAGACGTACTTTCCGGTGGCGTTGGCCGACGGCAAGTTTCACTGCATTATCCTCAAGGGCGGCGAGCAG
TATCCGTACTTTCCGCGGCCGCTGCTGTCTGAATTCGGGCTGTCAGTGCCGCTGAAGTCTCCGGGCCAGAGGAGG
AAGAAGAACAAGAGCAAGGGCAAGGTGAAGGGGACGACGAATGGAGACGACGAGGACGAGTTCATGACCAAGGAC
GACGACGACATCTTCAAGGGCGACGACGACAGCGACCAAGAGGGAGAAGAAGGGGGGGAAGAAGACGAGCGGACC
AGGCTGGAGCAGCAGTTTATGCTCCAGGGCGTACGGGCGGCGCAACTACGCGACGTGGTCTCGGCACGGCCCAAC
AGCCACAAGCAGCGCTCGCAGCTGTCGCGAGCGGAACTGGAAATCGACAAGGTGCTGCTGCAGCTGCTGGCGGTT
GAGTGCCGCGAGGGCGAGGAGCGCGGGATGAGAGCGCTGGAGATGGTGGCGCTGATGCGCGACAGGACGGGACGC
ATGATGGAGGCGGCTGGCAAGGTGGCTGAGCGGTACGGCCGGACCGTCCTGGGCGACAAGATCCGCGAGATTGGC
GAGCGGCGACACGCCCCTCACCCGCTCCAGACTCTCGTCCTTGACCCTCACGCCCCCCTCCGGGCCCTCCTCCTC
CACCACCAGATCCAGCAATCCCGTCCCCCCGTGGGAGAAGTGGCGGGCGTAAGGCTGCAGGCTGAACTGGCGGTG
CAGGAAGACGACGGCGTATCCCGCGGCAATGAGGTGTTCTGCGCTGGTGGCGCCGCGGGTTCCGGCGCTGAAGTT
GTCGATGAAGCGGACGGTTTGGCGCTCGAGGGGGACCGTTGTTCCGCCCGAGGTTACCAGGGCGACGCGACGGGT
TGGGATGGAGGCGTGGTGGGCGATGAAGGTGCGGGCGAGGGCGGTTTGGTGGTTGAGGTTGGGGGGAGGGGGGGT
GGAGGCGAAGTAGGCGGCTTCTGTGGAGGAGGAGGATTCTGGTGGTTGAGCTGA
Transcript >Ophun1|2756
ATGGAGCAGGCAATGGAACAGGCATTGGAGCAGTCACTGGAGCAGGCATCGGAGCAGGCATCGGAGCAGGCACTG
GAGCAGGCACCGGAGCAGTCAAAGGAGCAGTCAAAGGAGCAGTCAAAGGAGCAGTCACCGGAGCAGTCACTGGAG
CAGGCACCGGAGCAGTCACTGGAGCAGGCACAAGAACAGGAAGAGGCACAGACACAGGAAGAGATACAGACCCAG
GAAGAGACACAGACACAGGAAGAGACACAGACACAGGAAGAGACACAGACGCAGGATCAGGATAAGGATGAGGAT
GAGGAACAGACACAGGAAAAGAAAAAGACATCTCGCCCAGCTGATCAGAAACCTGAATTGCCACGGGCTCGTCCA
GCGCATACCCACGGCATAACGCGCTGCGCCTACTCAAAAAACGGCAAACGACTCGTTTCGGCTGGCTCCAACAAC
TTGATTCGGCTATGGACTGCAGGGCCAGTGCATAGCGAGCCTCTCAACATTGACGACTGCCAGGAACACAATGTC
TCCATCTCTGCCCACCACGATTTCTTCGTCGTTGGCTCCGAGGACGGTGTCGTCAGTCTCTACTCGTTCGAGCGC
AGGGTCTTTGAGCGCATGCTACTGCGCACGAGCTCGCCCGTCCGAGACGTGTCCCTTTCCCACGATGGCGAGTGG
TGTGCGATTGCCAGCGACGAGCGGAGCGTCAAGATTGTGCACACCAAGAATATAACCCGGATGCGCCACTTGCGA
GAGCATAACAGGGCCTCGAGACACGTCAGCTTGGACCCAAGCTCCTCTCTGGCCGCCGTCTCGTGCACCGATGGC
GTCGTCTATCTCTATTCCCTGACGTCGAACAAGCCCCAACTGATATGCAAGATCGACGGGGTCATCGCCGCGCTC
AAAGGCCACTCCACCGCATCGTACAAGCCAGTTTGGCATCCTGGAGGCAGCGTGTTTGCCCTTCCGACGCCGACA
AGAGACATCCAGGTCGTGTCCAGGCACGACGGCGAGAAGCAGTGGTGTTTTGCCGACGGGCATTCGGCCGAGATC
ACCTGCCTTGCCTGGTCGCCCAACGGAGCCATGCTGGCCTCGACGAGCAGAGACGGCAGGGTACTCATCTGGGAG
ACCGAGACGCATAGTGTCATCCAACGATATGACTTCGCCGACGTCGTGGACCTGACTTGGCATGTCTCTAGAAAC
CTGGCTTCTTTCACAACGCTCACCGGCGAGATTTACTTCCATTACGAGTTTGTGCCCGATCAATTCGTCTCGTTG
CTCAACCTGCCCCTGCAGACTGTGCCCTTGATCGAAAGACGCCGAGCCGAGACGCCCCATGTCCACGAGGACGTG
GATGTGCCGGCCGAGACGGTCAGGGATTTGAGCGCGCCGAGTCGCCAACGACGCGAGTCCTTCGGCAGCCTGGAC
TCTTTCCTCGACGCTGCCGCAGACGGACAAGCAGAAGATGACGACTTCGTGGTCGACGACGACGGTGCCGGATAC
GCGACGGGAAGCAAGAGACCATGGGACGGCGAAGGCCCTTCAGGGGAGCAAAAACGCATCAATCTCACGAGACGG
CAGCATCACGAAGCCTTTCAGCCCGGATCGACGCCGTGGCGAGGTAACCGCAAGTATCTTTGCCTCAACCTCATC
GGCGTCGTCTGGACCGTTGACCAGGACTCTCACCACACGGTGACGGTCGAGTTTTACGATCGCGACATGCAGCGC
GACTTTCACTTCACCGACACGTTCCTGTACGACAAGGCCTGCCTCAACGAACGCGGCGCCCTGTTCTCGTCGCCG
GCAAAGGACGACACGCCGGCGTACATCTTCTACCGGCCTCACGAGAGCTGGACGCAGCGTCACGACTGGCGTACG
CAGCTGCCGTTGGGCGAGGATGTGGTGGCCATGTCGCTGAGCGAGTCGTTTGTGACGGTGACGACGACGGCGAGC
TACGTGCGGGTGTATACGCTCCTCGGCATGCCCTACCGCCTGTACCGACCCAAGAGCGCGCCCGTGGTGACGTGC
GCGAGCTGGAGGGACTACGTCATGACGGTGGGCAACGGGCCCGTGGGCGCCGACGGCGCGACGCGGCTGTTGTAC
ACGATCGAGAACGTCAAGCGCGACCAGATTTGCCAGAACGAGGATACCGTCGCTCTACCTCAAGGGGCCACGCTC
AAGAGCGTCTTCTTCTCGGACGAGGGGGACCCTTGCATATACGATTCAACGGGAACGCTGCTGACGCTGCTTCAT
TGGCGGCGGCCGTCGCGGGCCTCGTGGGTGCCCGTGCTGGACACGAAGCTGCTGCCTCGACTGGCGTCTGGACGG
AAGCACGAGACGTACTTTCCGGTGGCGTTGGCCGACGGCAAGTTTCACTGCATTATCCTCAAGGGCGGCGAGCAG
TATCCGTACTTTCCGCGGCCGCTGCTGTCTGAATTCGGGCTGTCAGTGCCGCTGAAGTCTCCGGGCCAGAGGAGG
AAGAAGAACAAGAGCAAGGGCAAGGTGAAGGGGACGACGAATGGAGACGACGAGGACGAGTTCATGACCAAGGAC
GACGACGACATCTTCAAGGGCGACGACGACAGCGACCAAGAGGGAGAAGAAGGGGGGGAAGAAGACGAGCGGACC
AGGCTGGAGCAGCAGTTTATGCTCCAGGGCGTACGGGCGGCGCAACTACGCGACGTGGTCTCGGCACGGCCCAAC
AGCCACAAGCAGCGCTCGCAGCTGTCGCGAGCGGAACTGGAAATCGACAAGGTGCTGCTGCAGCTGCTGGCGGTT
GAGTGCCGCGAGGGCGAGGAGCGCGGGATGAGAGCGCTGGAGATGGTGGCGCTGATGCGCGACAGGACGGGACGC
ATGATGGAGGCGGCTGGCAAGGTGGCTGAGCGGTACGGCCGGACCGTCCTGGGCGACAAGATCCGCGAGATTGGC
GAGCGGCGACACGCCCCTCACCCGCTCCAGACTCTCGTCCTTGACCCTCACGCCCCCCTCCGGGCCCTCCTCCTC
CACCACCAGATCCAGCAATCCCGTCCCCCCGTGGGAGAAGTGGCGGGCGTAAGGCTGCAGGCTGAACTGGCGGTG
CAGGAAGACGACGGCGTATCCCGCGGCAATGAGGTGTTCTGCGCTGGTGGCGCCGCGGGTTCCGGCGCTGAAGTT
GTCGATGAAGCGGACGGTTTGGCGCTCGAGGGGGACCGTTGTTCCGCCCGAGGTTACCAGGGCGACGCGACGGGT
TGGGATGGAGGCGTGGTGGGCGATGAAGGTGCGGGCGAGGGCGGTTTGGTGGTTGAGGTTGGGGGGAGGGGGGGT
GGAGGCGAAGTAGGCGGCTTCTGTGGAGGAGGAGGATTCTGGTGGTTGAGCTGA
Gene >Ophun1|2756
ATGGAGCAGGCAATGGAACAGGCATTGGAGCAGTCACTGGAGCAGGCATCGGAGCAGGCATCGGAGCAGGCACTG
GAGCAGGCACCGGAGCAGTCAAAGGAGCAGTCAAAGGAGCAGTCAAAGGAGCAGTCACCGGAGCAGTCACTGGAG
CAGGCACCGGAGCAGTCACTGGAGCAGGCACAAGAACAGGAAGAGGCACAGACACAGGAAGAGATACAGACCCAG
GAAGAGACACAGACACAGGAAGAGACACAGACACAGGAAGAGACACAGACGCAGGATCAGGATAAGGATGAGGAT
GAGGAACAGACACAGGAAAAGAAAAAGACATCTCGCCCAGCTGATCAGAAACCTGAATTGCCACGGGCTCGTCCA
GCGCATACCCACGGCATAACGCGCTGCGCCTACTCAAAAAACGGCAAACGACTCGTTTCGGCTGGCTCCAACAAC
TTGATTCGGCTATGGACTGCAGGGCCAGTGCATAGCGAGCCTCTCAACATTGACGACTGCCAGGAACACAATGTC
TCCATCTCTGCCCACCACGATTTCTTCGTCGTTGGCTCCGAGGACGGTGTCGTCAGTCTCTACTCGTTCGAGCGC
AGGGTCTTTGAGCGCATGCTACTGCGCACGAGCTCGCCCGTCCGAGACGTGTCCCTTTCCCACGATGGCGAGTGG
TGTGCGATTGCCAGCGACGAGCGGAGCGTCAAGATTGTGCACACCAAGAATATAACCCGGATGCGCCACTTGCGA
GAGCATAACAGGGCCTCGAGACACGTCAGCTTGGACCCAAGCTCCTCTCTGGCCGCCGTCTCGTGCACCGATGGC
GTCGTCTATCTCTATTCCCTGACGTCGAACAAGCCCCAACTGATATGCAAGATCGACGGGGTCATCGCCGCGCTC
AAAGGCCACTCCACCGCATCGTACAAGCCAGTTTGGCATCCTGGAGGCAGCGTGTTTGCCCTTCCGACGCCGACA
AGAGACATCCAGGTCGTGTCCAGGCACGACGGCGAGAAGCAGTGGTGTTTTGCCGACGGGCATTCGGCCGAGATC
ACCTGCCTTGCCTGGTCGCCCAACGGAGCCATGCTGGCCTCGACGAGCAGAGACGGCAGGGTACTCATCTGGGAG
ACCGAGACGCATAGTGTCATCCAACGATATGACTTCGCCGACGTCGTGGACCTGACTTGGCATGTCTCTAGAAAC
CTGGCTTCTTTCACAACGCTCACCGGCGAGATTTACTTCCATTACGAGTTTGTGCCCGATCAATTCGTCTCGTTG
CTCAACCTGCCCCTGCAGACTGTGCCCTTGATCGAAAGACGCCGAGCCGAGACGCCCCATGTCCACGAGGACGTG
GATGTGCCGGCCGAGACGGTCAGGGATTTGAGCGCGCCGAGTCGCCAACGACGCGAGTCCTTCGGCAGCCTGGAC
TCTTTCCTCGACGCTGCCGCAGACGGACAAGCAGAAGATGACGACTTCGTGGTCGACGACGACGGTGCCGGATAC
GCGACGGGAAGCAAGAGACCATGGGACGGCGAAGGCCCTTCAGGGGAGCAAAAACGCATCAATCTCACGAGACGG
CAGCATCACGAAGCCTTTCAGCCCGGATCGACGCCGTGGCGAGGTAACCGCAAGTATCTTTGCCTCAACCTCATC
GGCGTCGTCTGGACCGTTGACCAGGACTCTCACCACACGGTGACGGTCGAGTTTTACGATCGCGACATGCAGCGC
GACTTTCACTTCACCGACACGTTCCTGTACGACAAGGCCTGCCTCAACGAACGCGGCGCCCTGTTCTCGTCGCCG
GCAAAGGACGACACGCCGGCGTACATCTTCTACCGGCCTCACGAGAGCTGGACGCAGCGTCACGACTGGCGTACG
CAGCTGCCGTTGGGCGAGGATGTGGTGGCCATGTCGCTGAGCGAGTCGTTTGTGACGGTGACGACGACGGCGAGC
TACGTGCGGGTGTATACGCTCCTCGGCATGCCCTACCGCCTGTACCGACCCAAGAGCGCGCCCGTGGTGACGTGC
GCGAGCTGGAGGGACTACGTCATGACGGTGGGCAACGGGCCCGTGGGCGCCGACGGCGCGACGCGGCTGTTGTAC
ACGATCGAGAACGTCAAGCGCGACCAGATTTGCCAGAACGAGGATACCGTCGCTCTACCTCAAGGGGCCACGCTC
AAGAGCGTCTTCTTCTCGGACGAGGGGGTAAGTTTGACGGTTTCCCAGGGCCGGTTCGGCGAGCTGACATTCCCC
GGACAGGACCCTTGCATATACGATTCAACGGGAACGCTGCTGACGCTGCTTCATTGGCGGCGGCCGTCGCGGGCC
TCGTGGGTGCCCGTGCTGGACACGAAGCTGCTGCCTCGACTGGCGTCTGGACGGAAGCACGAGACGTACTTTCCG
GTGGCGTTGGCCGACGGCAAGTTTCACTGCATTATCCTCAAGGGCGGCGAGCAGTATCCGTACTTTCCGCGGCCG
CTGCTGTCTGAATTCGGGCTGTCAGTGCCGCTGAAGTCTCCGGGCCAGAGGAGGAAGAAGAACAAGAGCAAGGGC
AAGGTGAAGGGGACGACGAATGGAGACGACGAGGACGAGTTCATGACCAAGGACGACGACGACATCTTCAAGGGC
GACGACGACAGCGACCAAGAGGGAGAAGAAGGGGGGGAAGAAGACGAGCGGACCAGGCTGGAGCAGCAGTTTATG
CTCCAGGGCGTACGGGCGGCGCAACTACGCGACGTGGTCTCGGCACGGCCCAACAGCCACAAGCAGCGCTCGCAG
CTGTCGCGAGCGGAACTGGAAATCGACAAGGTGCTGCTGCAGCTGCTGGCGGTTGAGTGCCGCGAGGGCGAGGAG
CGCGGGATGAGAGCGCTGGAGATGGTGGCGCTGATGCGCGACAGGACGGGACGCATGATGGAGGCGGCTGGCAAG
GTGGCTGAGCGGTACGGCCGGACCGTCCTGGGCGACAAGATCCGCGAGATTGGCGAGCGGCGAGTCGGATTTGCT
GATGATGGAGGAGGAGGAAGGGGGGGAGGAGGAGGAGGAGGAGGCGTTGCTGTCGTCTTGGTTGGCGGAAGATTG
GATCTTGTGTTCTGCCATTCGTGAGTCCGGCACGAAGAAATCGGATACCGCAGCGGCAAGGTAAAGAAGCGCCCT
GGGACCCAAAGGCCCCATCAAGCCAGCCAAAGCCCTGAGAGAATGAAGATAATCGCCAACGGTGACAAACGTCAA
CTCGAGCAGCATTCTCCTCTCCTTGACCCCCCGATACGTGCCCAGCACGCCCCTCACCCGCTCCAGACTCTCGTC
CTTGACCCTCACGCCCCCCTCCGGGCCCTCCTCCTCCACCACCAGATCCAGCAATCCCGTCCCCCCGTGGGAGAA
GTGGCGGGCGTAAGGCTGCAGGCTGAACTGGCGGTGCAGGAAGACGACGGCGTATCCCGCGGCAATGAGGTGTTC
TGCGCTGGTGGCGCCGCGGGTTCCGGCGCTGAAGTTGTCGATGAAGCGGACGGTTTGGCGCTCGAGGGGGACCGT
TGTTCCGCCCGAGGTTACCAGGGCGACGCGACGGGTTGGGATGGAGGCGTGGTGGGCGATGAAGGTGCGGGCGAG
GGCGGTTTGGTGGTTGAGGTTGGGGGGAGGGGGGGTGGAGGCGAAGTAGGCGGCTTCTGTGGAGGAGGAGGATTC
TGGTGGTTGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail