Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2755
Gene name
LocationContig_245:15395..18143
Strand+
Gene length (bp)2748
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13000 Acatn Acetyl-coenzyme A transporter 1 1.1E-81 179 388
PF13000 Acatn Acetyl-coenzyme A transporter 1 1.4E-25 391 472
PF13000 Acatn Acetyl-coenzyme A transporter 1 4.5E-53 476 644

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38318|YB70_YEAST Uncharacterized membrane protein YBR220C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR220C PE=1 SV=1 170 644 7.0E-146
sp|Q9USW4|YHZ9_SCHPO Uncharacterized protein C21B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.09 PE=4 SV=1 144 645 2.0E-119
sp|Q6AYY8|ACATN_RAT Acetyl-coenzyme A transporter 1 OS=Rattus norvegicus GN=Slc33a1 PE=2 SV=1 189 647 2.0E-99
sp|Q99J27|ACATN_MOUSE Acetyl-coenzyme A transporter 1 OS=Mus musculus GN=Slc33a1 PE=1 SV=1 189 647 3.0E-99
sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo sapiens GN=SLC33A1 PE=1 SV=1 189 647 1.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38318|YB70_YEAST Uncharacterized membrane protein YBR220C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR220C PE=1 SV=1 170 644 7.0E-146
sp|Q9USW4|YHZ9_SCHPO Uncharacterized protein C21B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.09 PE=4 SV=1 144 645 2.0E-119
sp|Q6AYY8|ACATN_RAT Acetyl-coenzyme A transporter 1 OS=Rattus norvegicus GN=Slc33a1 PE=2 SV=1 189 647 2.0E-99
sp|Q99J27|ACATN_MOUSE Acetyl-coenzyme A transporter 1 OS=Mus musculus GN=Slc33a1 PE=1 SV=1 189 647 3.0E-99
sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo sapiens GN=SLC33A1 PE=1 SV=1 189 647 1.0E-98
sp|P38317|YB69_YEAST Uncharacterized protein YBR219C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR219C PE=4 SV=1 546 645 2.0E-15
sp|Q9ZCG7|AMPG3_RICPR Putative transporter AmpG 3 OS=Rickettsia prowazekii (strain Madrid E) GN=ampG3 PE=3 SV=1 213 332 2.0E-06
sp|Q68VW8|AMPG3_RICTY Putative transporter AmpG 3 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ampG3 PE=3 SV=1 213 332 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008521 acetyl-CoA transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0000295 adenine nucleotide transmembrane transporter activity No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0071077 adenosine 3',5'-bisphosphate transmembrane transporter activity No
GO:0008514 organic anion transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0015215 nucleotide transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0015216 purine nucleotide transmembrane transporter activity No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005346 purine ribonucleotide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0015605 organophosphate ester transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 179 201 22
2 211 233 22
3 246 263 17
4 273 295 22
5 324 346 22
6 361 383 22
7 445 467 22
8 477 499 22
9 506 528 22
10 543 565 22
11 609 628 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2755
MTSNRKPSTRPPSTARGSGSRTLKAVTGAQARETIPFLYVKGLFTRVYLIALPLQSSRSKATNSTARPRSSTGPS
HTPPSLPTSAAATTSWKIARDGSSMSTRARRRPSSQNLAEKNANGKMQNGFEMRRKGGSPSKTGADSIMARSDFS
LDGPVPAGSRGSDSSRGFLELPRQDQRNFLLLVLLYFLQGIPMGLAMGSVPFLLKNHLSYGEIGTFSLASYPYSL
KLLWSPFVDAVWSRRMGRRKTWIVPIQFLSGLGMLWLGSRVEKMMATMGQAGGPTVWGFMLWWFFLVLMCATQDI
AVDGWALTLLSPANVSYASTAQTVGLTAGHFLSFTVFLALNASDLANRWLRSVPSEAGLVSLGGYLRLWGWAYIV
VTIGLALLKREERSRNDDGVWDVYRTMWGILKLRNVQAMIVVHLIAKLGFQANDGVTNLKLLDKGFGKDNMALTV
LIDFPFEIGLGYYAGMWSQRYTPMRLWCWGFMGRLAAAVVAQMTVMVFPAEGVTTWYLLLVIGEHVLSTFTNTVM
FVAVSAFHAKVSDPVIGGTYMTLLATVSNLGGTFPRYFVLRLVDALTVATCRGGPDDGQSCAVQAAKERCERARG
RCEVLQDGYHAVNVLCVAFGVVTFFWYIRPKVMHLQALPLRAWRLAR*
Coding >Ophun1|2755
ATGACCTCGAACCGCAAGCCCAGCACCAGGCCCCCATCGACGGCGCGCGGATCCGGATCGCGGACCTTGAAGGCT
GTGACGGGGGCGCAGGCGCGCGAGACGATCCCTTTTCTCTACGTCAAGGGGCTGTTCACGCGCGTCTACCTCATT
GCTCTCCCTCTCCAGTCGTCGAGAAGCAAGGCTACGAACAGCACAGCACGCCCACGGTCCTCGACGGGACCATCA
CATACACCTCCCTCCCTTCCCACCTCGGCGGCCGCTACGACGAGCTGGAAGATCGCTCGAGACGGTTCCTCCATG
AGTACTCGAGCCAGACGGCGGCCGTCCAGTCAGAACTTGGCGGAGAAGAATGCCAACGGCAAGATGCAAAATGGC
TTCGAGATGAGGCGCAAGGGCGGAAGCCCCTCCAAGACGGGCGCCGACAGCATCATGGCGCGATCCGATTTCTCC
CTCGATGGGCCGGTGCCGGCTGGCAGTCGCGGCAGTGACAGCAGCCGTGGGTTTCTGGAGCTGCCGCGACAGGAC
CAGCGCAACTTTTTGCTGCTGGTGCTGCTCTACTTCTTACAGGGCATTCCGATGGGGCTGGCCATGGGGTCGGTG
CCTTTTCTCCTCAAGAATCACCTCTCTTACGGCGAGATCGGGACGTTTAGCCTGGCGTCTTATCCTTACTCGCTC
AAGCTGCTATGGAGCCCGTTCGTCGACGCCGTGTGGAGTCGGCGGATGGGGCGGCGCAAGACGTGGATCGTGCCG
ATTCAGTTCCTGTCCGGCCTCGGCATGCTCTGGCTCGGGTCGCGGGTCGAGAAGATGATGGCGACCATGGGCCAG
GCTGGAGGGCCGACGGTTTGGGGGTTCATGCTGTGGTGGTTCTTCCTGGTACTGATGTGCGCGACGCAGGACATT
GCCGTCGACGGATGGGCGTTGACGCTGCTATCGCCGGCCAACGTGTCTTATGCGTCGACGGCGCAGACGGTGGGA
CTGACGGCCGGACACTTTCTCTCCTTTACCGTGTTCCTGGCCCTCAACGCGAGCGATCTCGCCAACCGGTGGCTG
CGGTCGGTGCCGTCCGAGGCCGGTCTCGTCTCGCTGGGCGGCTACCTCCGGCTCTGGGGCTGGGCATACATCGTG
GTGACGATAGGACTGGCGCTGTTGAAGCGCGAGGAGCGGTCTCGCAACGACGACGGCGTGTGGGACGTTTACCGG
ACCATGTGGGGGATCCTCAAGCTGCGCAACGTGCAGGCCATGATTGTGGTGCACCTCATCGCCAAGCTGGGCTTC
CAGGCCAACGACGGCGTCACCAACCTCAAGCTGCTGGACAAGGGCTTCGGCAAGGACAACATGGCGCTGACGGTG
CTCATCGACTTTCCCTTTGAGATTGGGCTCGGCTACTATGCCGGCATGTGGTCGCAGCGGTACACGCCGATGCGG
CTGTGGTGCTGGGGCTTCATGGGCCGGCTGGCGGCGGCCGTGGTGGCGCAGATGACGGTCATGGTGTTTCCGGCC
GAGGGCGTGACGACGTGGTATCTGCTTCTGGTGATTGGGGAGCACGTGCTGTCGACGTTTACCAACACGGTCATG
TTTGTGGCCGTGTCGGCCTTTCACGCCAAGGTGTCGGATCCGGTGATAGGGGGGACGTACATGACGCTGCTGGCG
ACCGTATCCAACCTGGGCGGCACGTTCCCCCGCTACTTCGTGCTGAGGCTCGTCGACGCGCTGACGGTGGCGACG
TGCCGCGGGGGGCCAGACGACGGCCAATCTTGCGCGGTGCAGGCGGCCAAGGAGCGGTGCGAGAGGGCTCGAGGC
CGGTGCGAGGTTCTGCAGGACGGATACCATGCCGTCAACGTGCTGTGCGTGGCCTTTGGCGTCGTCACCTTCTTC
TGGTACATCCGGCCCAAGGTGATGCATCTGCAGGCGCTGCCGCTGCGGGCGTGGCGGTTGGCGAGGTGA
Transcript >Ophun1|2755
ATGACCTCGAACCGCAAGCCCAGCACCAGGCCCCCATCGACGGCGCGCGGATCCGGATCGCGGACCTTGAAGGCT
GTGACGGGGGCGCAGGCGCGCGAGACGATCCCTTTTCTCTACGTCAAGGGGCTGTTCACGCGCGTCTACCTCATT
GCTCTCCCTCTCCAGTCGTCGAGAAGCAAGGCTACGAACAGCACAGCACGCCCACGGTCCTCGACGGGACCATCA
CATACACCTCCCTCCCTTCCCACCTCGGCGGCCGCTACGACGAGCTGGAAGATCGCTCGAGACGGTTCCTCCATG
AGTACTCGAGCCAGACGGCGGCCGTCCAGTCAGAACTTGGCGGAGAAGAATGCCAACGGCAAGATGCAAAATGGC
TTCGAGATGAGGCGCAAGGGCGGAAGCCCCTCCAAGACGGGCGCCGACAGCATCATGGCGCGATCCGATTTCTCC
CTCGATGGGCCGGTGCCGGCTGGCAGTCGCGGCAGTGACAGCAGCCGTGGGTTTCTGGAGCTGCCGCGACAGGAC
CAGCGCAACTTTTTGCTGCTGGTGCTGCTCTACTTCTTACAGGGCATTCCGATGGGGCTGGCCATGGGGTCGGTG
CCTTTTCTCCTCAAGAATCACCTCTCTTACGGCGAGATCGGGACGTTTAGCCTGGCGTCTTATCCTTACTCGCTC
AAGCTGCTATGGAGCCCGTTCGTCGACGCCGTGTGGAGTCGGCGGATGGGGCGGCGCAAGACGTGGATCGTGCCG
ATTCAGTTCCTGTCCGGCCTCGGCATGCTCTGGCTCGGGTCGCGGGTCGAGAAGATGATGGCGACCATGGGCCAG
GCTGGAGGGCCGACGGTTTGGGGGTTCATGCTGTGGTGGTTCTTCCTGGTACTGATGTGCGCGACGCAGGACATT
GCCGTCGACGGATGGGCGTTGACGCTGCTATCGCCGGCCAACGTGTCTTATGCGTCGACGGCGCAGACGGTGGGA
CTGACGGCCGGACACTTTCTCTCCTTTACCGTGTTCCTGGCCCTCAACGCGAGCGATCTCGCCAACCGGTGGCTG
CGGTCGGTGCCGTCCGAGGCCGGTCTCGTCTCGCTGGGCGGCTACCTCCGGCTCTGGGGCTGGGCATACATCGTG
GTGACGATAGGACTGGCGCTGTTGAAGCGCGAGGAGCGGTCTCGCAACGACGACGGCGTGTGGGACGTTTACCGG
ACCATGTGGGGGATCCTCAAGCTGCGCAACGTGCAGGCCATGATTGTGGTGCACCTCATCGCCAAGCTGGGCTTC
CAGGCCAACGACGGCGTCACCAACCTCAAGCTGCTGGACAAGGGCTTCGGCAAGGACAACATGGCGCTGACGGTG
CTCATCGACTTTCCCTTTGAGATTGGGCTCGGCTACTATGCCGGCATGTGGTCGCAGCGGTACACGCCGATGCGG
CTGTGGTGCTGGGGCTTCATGGGCCGGCTGGCGGCGGCCGTGGTGGCGCAGATGACGGTCATGGTGTTTCCGGCC
GAGGGCGTGACGACGTGGTATCTGCTTCTGGTGATTGGGGAGCACGTGCTGTCGACGTTTACCAACACGGTCATG
TTTGTGGCCGTGTCGGCCTTTCACGCCAAGGTGTCGGATCCGGTGATAGGGGGGACGTACATGACGCTGCTGGCG
ACCGTATCCAACCTGGGCGGCACGTTCCCCCGCTACTTCGTGCTGAGGCTCGTCGACGCGCTGACGGTGGCGACG
TGCCGCGGGGGGCCAGACGACGGCCAATCTTGCGCGGTGCAGGCGGCCAAGGAGCGGTGCGAGAGGGCTCGAGGC
CGGTGCGAGGTTCTGCAGGACGGATACCATGCCGTCAACGTGCTGTGCGTGGCCTTTGGCGTCGTCACCTTCTTC
TGGTACATCCGGCCCAAGGTGATGCATCTGCAGGCGCTGCCGCTGCGGGCGTGGCGGTTGGCGAGGTGA
Gene >Ophun1|2755
ATGACCTCGAACCGCAAGCCCAGCACCAGGCCCCCATCGACGGCGCGCGGATCCGGATCGCGGACCTTGAAGGCT
GTGACGGGGGCGCAGGCGCGGTAGGCGCAGCGTTGGAGGTGGGCGCGTTGCTGGGTGGCGCGGAGGGCGAGGAGG
GATTTCGTGGTGGGGGAGGAGGCGAGGAGGGTTGAGCATTGGATTTGGAGTTCTTTGCGGAGTGTTGCTGGGGGG
GGGGGGGGGGGGGGGGGGGGGGGGAGGTTAGCGACGCGTTTCTTGGTTTGAGTTGAGAGGAGTTGGGGTTTGGGT
TCGGGTTACCTTGTTCTCGGAGGTCTGCGAGCTCTTTATCGAGCGGACTCGTTTCCGAGGGGGACGCAGAGCCCA
TCTCCATGGCGATGCTTCCAGCAGAGGTGACGATGGTGGTGGGAATTAAAGATGACGCTATAATAAATCACGTTC
CCCATTAAACGAGAAACGCGGGATAGGGGAAAGACAAAGCGTGACTGTGCACGTGACGTACAAGCTAGCTAAGCT
GCAGGTACCTTGTACCCAGCCCCTGGCAACTCGGGCCTCGAAACCAACAAGTATGACGCTGGCCTCTTCGCAGTG
CAGCCTCAAGCCGACACTCTGACTGATTCATCTACCCGGTTTCCAACGACTTAGAATCCGACACTTTGTTTCGAT
ATTGTTTTCCGAATTTGCTGTTGTTTTCCAGCCTTCAGAGGGCGGGAGGTTTTGAAAAAAAAAAAAAGGGTCGGA
AGGGAAGAGAAAAGTTAGGTCCGTCGCATTCAGGCCACGGTTGCGTTTCGACCGCAACTGCGTTACAGCGAGACG
ATCCCTTTTCTCTACGTCAAGGGGCTGTTCACGCGCGTCTACCTCATTGCTCTCCCTCTCCAGTCGTCGAGAAGC
AAGGCTACGAACAGCACAGCACGCCCACGGTCCTCGACGGGACCATCACATACACCTCCCTCCCTTCCCACCTCG
GCGGCCGCTACGACGAGCTGGAAGATCGCTCGAGACGGTTCCTCCATGAGTACTCGAGCCAGACGGCGGCCGTCC
AGTCAGAACTTGGCGGAGAAGAATGCCAACGGCAAGATGCAAAATGGCTTCGAGATGAGGCGCAAGGGCGGAAGC
CCCTCCAAGACGGGCGCCGACAGCATCATGGCGCGATCCGATTTCTCCCTCGATGGGCCGGTGCCGGCTGGCAGT
CGCGGCAGTGACAGCAGCCGTGGGTTTCTGGAGCTGCCGCGACAGGACCAGCGCAACTTTTTGCTGCTGGTGCTG
CTCTACTTCTTACAGGGCATTCCGATGGGGCTGGCCATGGGGTCGGTGCCTTTTCTCCTCAAGAATCACCTCTCT
TACGGCGAGATCGGGACGTTTAGCCTGGCGTCTTATCCTTACTCGCTCAAGCTGCTATGGAGCCCGTTCGTCGAC
GCCGTGTGGAGTCGGCGGATGGGGCGGCGCAAGACGTGGATCGTGCCGATTCAGTTCCTGTCCGGCCTCGGCATG
CTCTGGCTCGGGTCGCGGGTCGAGAAGATGATGGCGACCATGGGCCAGGCTGGAGGGCCGACGGTTTGGGGGTTC
ATGCTGTGGTGGTTCTTCCTGGTACTGATGTGCGCGACGCAGGACATTGCCGTCGACGGATGGGCGTTGACGCTG
CTATCGCCGGCCAACGTGTCTTATGCGTCGACGGCGCAGACGGTGGGACTGACGGCCGGACACTTTCTCTCCTTT
ACCGTGTTCCTGGCCCTCAACGCGAGCGATCTCGCCAACCGGTGGCTGCGGTCGGTGCCGTCCGAGGCCGGTCTC
GTCTCGCTGGGCGGCTACCTCCGGCTCTGGGGCTGGGCATACATCGTGGTGACGATAGGACTGGCGCTGTTGAAG
CGCGAGGAGCGGTCTCGCAACGACGACGGCGTGTGGGACGTTTACCGGACCATGTGGGGGATCCTCAAGCTGCGC
AACGTGCAGGCCATGATTGTGGTGCACCTCATCGCCAAGCTGGGCTTCCAGGCCAACGACGGCGTCACCAACCTC
AAGCTGCTGGACAAGGGCTTCGGCAAGGACAACATGGCGCTGACGGTGCTCATCGACTTTCCCTTTGAGATTGGG
CTCGGCTACTATGCCGGCATGTGGTCGCAGCGGTACACGCCGATGCGGCTGTGGTGCTGGGGCTTCATGGGCCGG
CTGGCGGCGGCCGTGGTGGCGCAGATGACGGTCATGGTGTTTCCGGCCGAGGGCGTGACGACGTGGTATCTGCTT
CTGGTGATTGGGGAGCACGTGCTGTCGACGTTTACCAACACGGTCATGTTTGTGGCCGTGTCGGCCTTTCACGCC
AAGGTGTCGGATCCGGTGATAGGGGGGACGTACATGACGCTGCTGGCGACGTGAGTCTCTTCTCTGCTCTCTTCT
GCCCCCCCCGTTGCCTCTCCTTGATGCCTGATGTACTGACACAAGGCGACAAACAGCGTATCCAACCTGGGCGGC
ACGTTCCCCCGCTACTTCGTGCTGAGGCTCGTCGACGCGCTGACGGTGGCGACGTGCCGCGGGGGGCCAGACGAC
GGCCAATCTTGCGCGGTGCAGGCGGCCAAGGAGCGGTGCGAGAGGGCTCGAGGCCGGTGCGAGGTTCTGCAGGAC
GGATACCATGCCGTCAACGTGCTGTGCGTGGCCTTTGGCGTCGTCACCTTCTTCTGGTACATCCGGCCCAAGGTG
ATGCATCTGCAGGCGCTGCCGCTGCGGGCGTGGCGGTTGGCGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail